(data stored in ACNUC7421 zone)

EMBL: BA000007.PE214

BA000007.PE214       Location/Qualifiers
FT   CDS_pept        complement(243979..245388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33640"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33640"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBT0"
FT                   /protein_id="BAB33640.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESL
FT                   LTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVL
FT                   NGEFNLFNTKW"
     atgaatagta acgtactgac acaaactatc gttaccggca gtgacccgcg cgggctgccg        60
     gaattcagcg ccatccgcga ggaaataaac aaagccagcc acccgtcaca gcctgagctg       120
     aactggaaac tggtggagtc gctggcgctg gcgattttta aagccaacgg tgtggattta       180
     cacaccgcca cctactatac gcttgcccgg acacggacac agggactggc gggattctgc       240
     gaaggtgcgg aactgctggc ggcaatggta agccacgact gggataagtt ctggccgcag       300
     ggcggcccgg cgcgtactga aatgctggac tggtttaact cccgaaccgg caatattctg       360
     cgtcagcaaa tctcctttgc ggaatccgac ctaccactga tctaccgcac agagcgggca       420
     ttgcagctta tctgcgataa gctccagcag gtggaactga agcgcgttcc gcgcgtggag       480
     aatctgctct attttatgca gaacacgcgt aaacggcttg aaccccagct gaagagtaac       540
     actgagaacg ccgcacagac cacggtcaga acgctgattt atgccccgga aacacaggca       600
     tcttccacac cagaagcggt agtgcctccc ctgcccggcc tgcctgagat gaaagtggaa       660
     gtgcgcagtc tgacagagaa tcccccacag gccagtgtga taaagcaagg cagtacggta       720
     agagggttta tcgcagggat cgcctgttca gtggctgtcg cctcagcatt gtggtggtgg       780
     caggtctatc cggtgcagca gcaactgtta caggttaacg acaccgctca gggcgcagca       840
     acggtgtgga tggcctcacc tgaactcgaa aactatgagc gcaggctgca acaacttctt       900
     gatacctccc cggtacagcc gctggaaacc gggatgcaga tgatgcgtgt tgccgacagt       960
     cgctggccgg aaagcctgca acagcaacag gcctcgacac aatggaatga ggcactcaaa      1020
     acccgcgcac agagtagccc gcagttgcgt ggctggttgc agacccgcca ggacttacat      1080
     gcttttgcag atctagtgat gcagcgcgag aaagagggac taaccctttc ctatatcaaa      1140
     aatgtcatct ggcaggcgga gcggggactg gggcaggaaa cacccgttga gtctctgttg      1200
     acgcagtacc aggatgcccg tgcgcagaag cagaatacag atgcgctgga aaaacaaatt      1260
     aatgagcgac tcgaaggcgt gttaagccgc tggctgctgc tgaagaataa tacgataccg      1320
     acgataaaaa aagcattgaa tttcaataac attcatgaat acaaaggagt tttaaatggc      1380
     gaatttaatt tatttaacac taaatggtga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page