(data stored in ACNUC7421 zone)

EMBL: BA000007.PE217

BA000007.PE217       Location/Qualifiers
FT   CDS_pept        complement(250386..251129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0222"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33645"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33645"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V9"
FT                   /protein_id="BAB33645.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
     atgagcaggt tgcgcgtttt ccggcagaca ggatggttta tcgcgggcct gatgacgggc        60
     ttacccgcca ctgccgcgcc cgcagaagca tcgtcaatgg ccggtgtggc ggtcgccgtc       120
     gccaccacga ccccgccgga tgcgacagcc acgttacagg ccatgcagtc ctgtcggcgg       180
     gagtccgcgg cgctggagcg gcttgactgc tatgaccacc tgctggcacc gctgtccccg       240
     tcagggtttg acggggcgct ggtcaaagcc ggttttgtgg gcgaggcctg gacccgcgcc       300
     acagagcagg aaaaacgccg cgagggcaac accacagaac tgctggtgac gcaggtgccg       360
     ggggagcgcc cgacggtggt gataaccacc ccggctatcg gccatgttcc gccgcgcccg       420
     gtgctgatgt tcagttgcgt ggacaatatc acccggatgc aggtggcgct gatgcaccct       480
     ctggatgtcc atgatatcgc cgtcactctg aatgccgaca gccgggcatt gcgcagccac       540
     tggtttgtgc gcgagaacgg caccctgctg gagtccagcc gggggctgtc cgggattgat       600
     gaaattaagc aactgttcgg cgcaaaaacg ctgacagtgg ataccggcgc agataacgcc       660
     gcaggaaagc tgacctttaa cattgacggg ctggcaaggg cgattgcccc cctgcgcgat       720
     gcctgccact gggcgggaga ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page