(data stored in ACNUC7421 zone)

EMBL: BA000007.PE224

BA000007.PE224       Location/Qualifiers
FT   CDS_pept        complement(258878..260728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0229"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33652"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33652"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U6"
FT                   /protein_id="BAB33652.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
     atggaatttg aagaacgcta ttttcgggaa gaactcgatt acctgcgcca gcttagcaag        60
     ctgctggcaa cggaaaaacc ccatctggcc cgcttcctgg ccgaaaaaga tgcggatccg       120
     gatattgaac gcctgctgga aggggtggct tttcttaccg gcaatctccg ccagaaaatt       180
     gaggatgaat tcccagaact gacgcacggg cttattaaga tgctatggcc taattacctg       240
     cgtccggttc cggcaatgac ccttattgaa tatacgccgg atatggataa gtcttctgta       300
     ccggtgttaa tcccccgtaa tgagcagttt acaaccaacg ccggggaaat cagagttgat       360
     gaagtgctgc cctctgatgc taaaaaggag gagccgcctc cctgtacctt caccctctgc       420
     cgggatatct ggctgctgcc cgttcgcctg gagcagattg aaaaccgcag tacgacccgt       480
     aatggtgtta tcaacatcac cttttcggtc gcaccgggaa cggacttccg cacgctggat       540
     ctgaacaaac ttcgcttctg gctcggcaat gacgacaact atacccgtga ccagctttat       600
     ttatggttct gcgaatactt gcagggtgcc gacctgactg tgggtgaaca gcatattcgc       660
     ctgcctgagt ttatgctaaa agctgtcggt tttgagccgc aggatgccat gctgccctgg       720
     ccgaaaaacg tccacagcgg ctaccggatc cttcaggagt atttctgtta ccccgatgcg       780
     tttctctttt ttgatctttg tggttgtccg gctttgcctg acggattgca ggcggaattc       840
     tttaccctgc aactgcgttt ttcgcgccct ttgcccgtgg acatccggct gcgccgcgat       900
     tccctgcgcc tgtattgcgc acctgccatt aatttattta tccaccatgc agaagccatc       960
     acgctggaca accggcgggc agactatccg ctggttccca gccgccatta cccacaacat      1020
     tacgatgtat tttccgttaa cagtgtggtg agccaggtcc aggatatgtt caggaaaaaa      1080
     gatctggggc gtcctgtttc gacgcaggcc gcgcgccagt ggccagcctt tgaaagtttc      1140
     agccatcaga tggaatacag ccggaagcgg gaggtggtgt actggcatca ccggaccaaa      1200
     acatccctgt tccatcgcgg ctttgatcat acccttgcct ttatacatgc tgatggcagt      1260
     tatccgtcag acgaatctct gctcagtaat gaagtggttt cggtatcgct gacctgtacc      1320
     aaccgtgagc ttccgtcaca aattcgttcc ggcgatatca ccggcacaac cggtaaaaat      1380
     gcggctgttg cttcctttcg caacattacc cgcccgacgc aaccactctg gccggtcatt      1440
     gatggcagcc tgcactggtc cctgctctcc gccatgaacc tgaattatct gtcattactg      1500
     gatacggacg cgctgaagca ggtcatcgcc aactttgatc gccacgcaat ccaccatccg      1560
     cagacggcgc ggctgtcaca acaaaagctg gatgccattg agcgtctgga gacccgcccc      1620
     gttgatcgcc tgtttacggg tattcccgtc cggggactgg cctccacgct gtatctgcac      1680
     ccggagccgt ttgtctgtga aggggaaatg tatctgctcg gtacggtgct ttcgcatttt      1740
     ctgtcgctgt acgccagcgt taactcattc cacatgctga ccgttgtgaa cacagaaagc      1800
     caggagacat ggaaatggac ggaaagaatc gggcagcatc ctcttatctg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page