(data stored in ACNUC7421 zone)

EMBL: BA000007.PE225

BA000007.PE225       Location/Qualifiers
FT   CDS_pept        complement(260732..261145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0230"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33653"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33653"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U0"
FT                   /protein_id="BAB33653.1"
FT                   /translation="MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
     atgatactgg atcgggaaag aaccacaggt tctctttttg agcgtatgga agcctcttcg        60
     gccagaaacc ggcagggagg cagtattcat tcgctcaggc aatccattcg ccagaaccta       120
     agaaacattc ttaatacccg gtccggtagt tgccggggtg cgcctgagct gggcattgat       180
     gaaccggaag gggctgaaaa cttccgcgaa tccatgagtc gggccatcga gcaatgtata       240
     gaacgctatg aaccccggat ctcacacgct gaagtgcagg cagtggtttc atccgcctcc       300
     agcccgctgg atatgacgtt tcatattaca gcctgggtga catttaacga aacgcatgag       360
     gtgcttgaat ttgatatggc accgaatggc agccagcatt accgggtgga ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page