(data stored in ACNUC7421 zone)

EMBL: BA000007.PE229

BA000007.PE229       Location/Qualifiers
FT   CDS_pept        264134..264652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0234"
FT                   /product="Hcp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33657"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33657"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC35"
FT                   /protein_id="BAB33657.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
     atgccaacac cgtgttatat ctccatcact ggtcagaccc agggaaatat tactgcaggt        60
     gcatttaccg ctgattctgt cggcaacatc tatgtgcagg ggcacgaaga cgagatgctg       120
     gtgcaggaat tcctgcataa cgttactgtc ccgaccgatc ctcagtccgg tcagcctgcg       180
     ggtcagcgtg ctcacaagcc tttcattttt accgtggcgc tgaacaaagc ggttccgctg       240
     atgtacaacg cactggcctc cggcgaaatg ctgccaacca ctgaacttca ctggtggcgt       300
     acctctgtgg aaggcaaaca ggagcattat ttcactaccc gcctgactga ttcgacgatt       360
     gtcgatatga aactgcatat gccgcattgc caggacccgg cgaaacgcga gttcacccag       420
     ttgctcgaag tttcactggc ctaccgcaaa attgaatggg aacacgtcaa atctggcacc       480
     tccggtgccg acgactggcg cgcaccgctg gaagcataa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page