(data stored in ACNUC7421 zone)

EMBL: BA000007.PE234

BA000007.PE234       Location/Qualifiers
FT   CDS_pept        273792..275552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0242"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33665"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33665"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R9"
FT                   /protein_id="BAB33665.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDC
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYRPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
     ttgccctggc tgcaccgtga gacggcccgc agcttcggcg gggcgggcag tacagcgggg        60
     tacgaacagg tcacggcgta caccctcaca gggcagctac agagcaggca cctgaacctc       120
     ccgcagcttg actgtgacta cgactggaac gacaacggac agctaatccg catcagcggc       180
     ccgcaggaga gccgggagta ccgttacagc gacacgggaa ggctgacggg cgtccacacc       240
     acggcagcga acctggatat cgatatcccg tatgcaacgg acccggcagg aaaccggctg       300
     ccggacccgg aactgcatcc ggacagcacg ctcacggcgt ggccggataa ccgcatcgcg       360
     gaagatgcgc actatgtcta ccgctacgat gaatacggca ggctgacgga gaagacggac       420
     cgcattccgg aaggggttat ccggatgcac gacgagcgga cccaccacta ccattacgac       480
     aaccagcacc gcctggtgtt ctacacgcgg atacaatacg gcgagccgct ggtcgagagc       540
     cgctacctct atgacccgct gggccgccgg acggggaaac gggtgtggcg gcgggagcgt       600
     gacctgacgg ggtggatgtc gctgtcgcgt aaaccggagg tgacctggta cgggtgggac       660
     ggcgacaggc tgacgacggt acagaccggc accacacgta tccagacggt ataccggccg       720
     gggagcttca caccgctcat ccgcatcgaa acggagaacg gcgagcggga gaaagcgcag       780
     cgccgcagcc tggcggagaa actccagcag gaagggagtg aggacggtca cggtgtggtg       840
     ttcccggcag aactggtgag gatgctggac aggctggagg aagaaatccg ggcagaccgc       900
     gtgagcagtg aaagccgggc gtggcttgcg cagtgcggac tgacggtgga gcaactggaa       960
     aaacaggtgg agccggaata cacgccggcg cgcacgctgc atctgtacca ctgtgaccac      1020
     cggggactgc cgctggcgct tatcagcgaa gacggcaata cggcgtggag cgcggaatat      1080
     gatgaatggg gcaaccagct taatgaggag aacccgcatc acctgcacca gccgtaccgt      1140
     ctgccgggcc agcagcatga tgaggagtcg gggctgtact ataatcgtca ccggtactac      1200
     gatccgttgc aggggcggta tatcaccccg gacccgattg ggttgagagg tggatggaat      1260
     atgtatcagt atccgttgaa tcccatacaa gtgatagacc caatggggtt agatgcgatt      1320
     gagaatatga catcaggtgg actaatttat gccgtatctg gtgtacctgg attgattgtt      1380
     gcaaacagca ttactaacag tgcttaccag ttcggttatg atatggatgc tattgttggc      1440
     ggagctcata atggggccgc cgatgcaatg agatattgtt acttgatgtg tcgaatgact      1500
     aagacatttg gatcaacaat agctgacgtg ataggtaaaa atcatgaggc ggctggggat      1560
     agacaaggtc agccagctaa agaaagaatc atggatctta aaaataacac tgtcggtatt      1620
     gcttgtggcg atttttctgc caaatgtagc gatgcatgta ttgaaaaata taacattggg      1680
     caactcttcg ggttagatgg tataaaagca gataatccaa taaaagcaaa gcaagggagt      1740
     tcagatgctt caaattatta g                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page