(data stored in ACNUC7421 zone)

EMBL: BA000007.PE236

BA000007.PE236       Location/Qualifiers
FT   CDS_pept        275754..276017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33667"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R7"
FT                   /protein_id="BAB33667.1"
FT                   /translation="MVNNYKTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
     atggttaata attacaagac gcactgtgga gtggttgata taaatcttaa ttttttcaat        60
     gatattcttt atagcgtgcg attaaaaaac attagtaaac tggagaatat ggagttctgc       120
     gctacaaaac aacgggtgta ttttagtgat aaaaacaaga aggctagtta taaaataatt       180
     aattatggag actattatga tgttgattat tatgataaca atttgaaaaa tgaagttttt       240
     gactggattg gtaaatggtc ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page