(data stored in ACNUC7421 zone)

EMBL: BA000007.PE265

BA000007.PE265       Location/Qualifiers
FT   CDS_pept        complement(301423..301812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33696"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33696"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M6"
FT                   /protein_id="BAB33696.1"
FT                   /translation="MKKAAILIDAGFFMQRVHATHRKHFAEHELTAQCIMKVIWSMVLS
FT                   HLNGKRQSQERREPLELYRIYFYDCPPLDIQTRLPLPEPGNKTPGRKNFKLEKSYILRT
FT                   ELHEELRKTRKTPIVFILKLIGATH"
     atgaagaaag cagcaatttt aattgatgcg ggttttttca tgcagcgtgt tcatgctacg        60
     catcgtaaac acttcgccga gcatgaactg actgcgcaat gcataatgaa agtaatatgg       120
     tcaatggttc tttcccatct taatggaaaa cgtcaatcac aagaacgtag ggaaccgctt       180
     gagctttata gaatttactt ctatgactgt ccaccactcg acattcaaac acgccttcca       240
     cttcctgagc ctggcaataa gacgcctggt cgcaagaatt tcaaactcga aaaatcatat       300
     attctgagaa cggagctgca tgaagagtta agaaaaactc gaaaaacacc aattgtattt       360
     attttaaaat taataggtgc aactcactaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page