(data stored in ACNUC7421 zone)

EMBL: BA000007.PE266

BA000007.PE266       Location/Qualifiers
FT   CDS_pept        complement(301940..302653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0274"
FT                   /product="phage repressor protein CI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33697"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33697"
FT                   /db_xref="GOA:Q8X7M5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M5"
FT                   /protein_id="BAB33697.1"
FT                   /translation="MSAKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
FT                   SGVGALFNGINALNAYNAALLAKILNVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
FT                   PVFSHVQAGMFSPELRTFTKGDAEKWVSTTKKASGSAFWLEVEGNSMTAPTGSKPSFPD
FT                   GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
FT                   VGKVIASQWPEETFG"
     atgagcgcaa aaaagaaacc attaacacaa gagcagcttg aggacgcacg tcgccttaaa        60
     gctatttatg aaaaaaagaa aaatgaactt ggcttatccc aggaatctgt cgcagacaag       120
     atggggatgg ggcagtcagg cgttggtgct ttatttaatg gcatcaatgc attaaatgct       180
     tataacgccg cattgcttgc aaaaattctc aacgttagcg ttgaagaatt tagcccttca       240
     atcgccagag aaatctacga gatgtatgaa gcggttagta tgcagccgtc acttagaagt       300
     gagtatgagt accctgtttt ttctcatgtt caggccggga tgttctcgcc tgagcttaga       360
     acctttacca aaggcgatgc ggagaaatgg gtaagcacaa ccaaaaaagc cagtggctct       420
     gcattctggc ttgaggttga aggtaattcc atgaccgcac caacaggatc caagcccagc       480
     tttcctgacg ggatgttaat tctggttgac cctgagcagg ctgttgagcc aggcgatttc       540
     tgtatagcca gacttggtgg tgatgagttt accttcaaga aactgatcag ggatagcggt       600
     caggtgtttc tacagccact aaacccacaa tacccaatga tcccatgcaa tgagagttgt       660
     tccgttgtgg ggaaagttat cgctagtcag tggcctgaag agacgtttgg gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page