(data stored in ACNUC7421 zone)

EMBL: BA000007.PE268

BA000007.PE268       Location/Qualifiers
FT   CDS_pept        303073..303366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0276"
FT                   /product="phage regulatory protein CII"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33699"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33699"
FT                   /db_xref="GOA:Q8X7M4"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M4"
FT                   /protein_id="BAB33699.1"
FT                   /translation="MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKR
FT                   DWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF"
     atggttcgtg caaacaaacg caacgaggct ctacgaatcg agagtgcgtt gcttaacaaa        60
     atcgcaatgc ttggaactga gaagacagcg gaagctgtgg gagttgataa gtcgcagatc       120
     agcaggtgga agagagactg gattccaaag ttctcaatgc tgcttgctgt tcttgaatgg       180
     ggggtcgttg acgacgacat ggctcgattg gcgcgacaag ttgctgcgat tctcaccaat       240
     aaaaaacgcc cggcggcaac cgagcgttct gaacaaatcc agatggagtt ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page