(data stored in ACNUC7421 zone)

EMBL: BA000007.PE271

BA000007.PE271       Location/Qualifiers
FT   CDS_pept        304629..305423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0280"
FT                   /product="phage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33703"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33703"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDH9"
FT                   /protein_id="BAB33703.1"
FT                   /translation="MAKNDFKAFATDRNANVMSQEEWEALPALISGFTAGKASSAQVNK
FT                   VIRQASFIAAALAQFVSDKTQRDVLDNGDLPGFVELLGSGFAVEYLSRKNPFGDIKSDG
FT                   TVKTALQNLGLGEGAPAIGVPFFWPSAAMPNTVIDSWSCMVFLKFNGAKFSATDYPVLA
FT                   KVFPSLVLPEARGDFIRIWDDGRGADGGRELLSWQAATNFSQFAGNIGEGAGHAINFHD
FT                   GIAGNQPGFSRFNFTSNSVGDGVNFVAVRPRNIAFNFLVRAK"
     atggcgaaaa atgactttaa agcgtttgca actgatcgaa atgccaatgt tatgtcgcag        60
     gaggaatggg aagcgttgcc tgcgcttata tccggattta cagcagggaa agcatccagt       120
     gcgcaagtca ataaggttat tcggcaggcc agctttattg ctgcagctct ggcccagttt       180
     gtaagtgata aaacgcaacg ggatgtgctt gataatggtg atctgcccgg ttttgttgaa       240
     ttgctgggat cggggtttgc tgttgaatac ctgagccgca agaatccgtt tggcgatatc       300
     aaatcggacg gcacggtgaa aacggctctt caaaaccttg gtttgggaga aggtgctcca       360
     gctattggcg ttccgttctt ctggccgtcc gctgcaatgc caaatactgt aatcgacagc       420
     tggtcctgta tggtgttttt gaagttcaac ggcgcgaaat tctctgccac tgattatcct       480
     gtgctggcga aagtgtttcc ttcgctggta ttacctgaag cccgcggtga tttcattcgt       540
     atctgggatg acgggcgagg tgcagacggt ggtcgcgaat tattaagctg gcaggcagct       600
     acaaactttt ctcagtttgc cgggaatata ggcgaaggtg cgggacacgc aattaacttt       660
     catgatggca tcgccggaaa tcagccagga ttttcacgat ttaatttcac cagtaactct       720
     gtgggtgatg gtgtgaattt tgttgcagtc agaccgcgaa atattgcatt taactttctg       780
     gtgagggcta aataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page