(data stored in ACNUC7421 zone)

EMBL: BA000007.PE276

BA000007.PE276       Location/Qualifiers
FT   CDS_pept        complement(307504..308277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33708"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33708"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7L0"
FT                   /protein_id="BAB33708.1"
FT                   /translation="MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAADDDDLLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRIN
FT                   VSRASKAEVILATVRGIVRGVFIADKWLKSTREHFPTMKYWDEDPDFEATQSSRYGFEG
FT                   REAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF"
     atggatatta ctgagtttcc ttctggagta attgaacacc ttggctggta tgtataccga        60
     ttgattgatc ctagggacgg aagcaccttc tatgtaggga aaggcaaagg taaccgcgta       120
     tttgcccata tgcgcggtga agtggcagcg gctgatgatg acgacttact gagcaacaag       180
     ctaaagcaaa tcagagaaat aagattagcg ggacttgaag ttatccatgt catccatcga       240
     catggaatga ctgatgaaaa gacggcgtac gaagttgaag cagcacttat tgatgcctac       300
     cctgggttaa cgaatatcat gaatggtgct ggcagcaatg aattcggcgc cgcgcatgtc       360
     aaagagttga tagcaacata tcaacccgaa accataacat ttcatcataa agcattaatg       420
     atttccgtta acagaagtgc aaaagattca gagctttatg atgcggttcg atttagctgg       480
     cgcattaatg tctcgcgcgc cagtaaagca gaagtcattc ttgctactgt aagggggatc       540
     gttcgaggag ttttcattgc tgataaatgg ctaaaatcaa cgcgtgaaca ttttcctacg       600
     atgaaatact gggacgaaga ccctgacttt gaggcaacac aaagctctcg ctatggtttt       660
     gaaggtcgag aagccccacc tgaaatagca aacctttatc ttgggaaaaa aataccagat       720
     gaattaagaa aaaaaggagc tatgtctcca gttcgttact cacctaattt ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page