(data stored in ACNUC7421 zone)

EMBL: BA000007.PE280

BA000007.PE280       Location/Qualifiers
FT   CDS_pept        311992..312408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33713"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K6"
FT                   /protein_id="BAB33713.1"
FT                   /translation="MSQPLSEILTWDDEQWEVFVHDWLIVCKSDDYPWSERLGGAGDKG
FT                   RDVVGYKSDPNVEGYSWDNYQCKLYKKSLGFSDVVVEFGKLIYFTLNGDYPIPQKYFFV
FT                   APYDLSTTFSNLLKNKNELKKAVLDSWDSAISKK"
     gtgtctcaac cactttcgga aatattgaca tgggatgatg aacaatggga ggtatttgtc        60
     catgattggc ttattgtctg taaatcagat gattacccgt ggagcgaacg tttgggagga       120
     gctggagata aaggtagaga cgttgttgga tataaatcgg atcctaacgt agaaggttat       180
     tcttgggata attatcaatg caaactgtac aaaaaaagtt tagggttctc tgatgttgta       240
     gttgagtttg gaaaacttat ctattttact ctgaatggtg attatcccat ccctcagaag       300
     tacttttttg tggcacccta tgatttatct actacatttt ctaatttatt gaaaaataaa       360
     aacgagctta aaaaagcagt ccttgattca tgggattcag caatttcaaa aaaataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page