(data stored in ACNUC7421 zone)

EMBL: BA000007.PE281

BA000007.PE281       Location/Qualifiers
FT   CDS_pept        312381..312998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33714"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33714"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K5"
FT                   /protein_id="BAB33714.1"
FT                   /translation="MGFSNFKKITKKIDIPLDDEIKKYIEDFDFSIFYSLPLSLILNDI
FT                   ANTHLYFKYFNELYVVRIPPNEIPTYNSKKESVYVNALLQAYSEHGNKTYSSFLELDDP
FT                   YRRHFNNSRNDFYFASSLEVFVREVFKDDVFKALKCYISSSIEPVFYEDHNYAFIRCNA
FT                   VLKQAVLTPIAHSVLSKICEANDKKGICHHLVNDGEVIWTVR"
     atgggattca gcaatttcaa aaaaataact aaaaagattg atattccatt agatgatgaa        60
     ataaaaaaat atattgagga ttttgatttt agtatttttt actctctacc cttatcattg       120
     attttaaatg atattgcaaa tacacacctt tattttaagt actttaacga gctgtatgtc       180
     gtgagaatcc ctccaaatga aattccaaca tacaattcaa aaaaagagtc tgtatatgtt       240
     aatgcactgc ttcaagccta ttcagagcat ggaaataaaa cttatagttc tttcttagag       300
     cttgatgatc catacagacg acactttaat aatagtagaa atgattttta ttttgcatct       360
     tcgcttgagg tttttgtccg cgaagtattt aaagatgatg tattcaaagc attgaaatgt       420
     tacatttcat cttcaattga acccgtcttt tatgaagacc ataattatgc atttattagg       480
     tgtaatgcag tcttgaagca ggctgttctg acaccaattg cacattcagt actatcaaaa       540
     atatgtgaag caaatgataa aaaaggaata tgccatcatt tggttaatga tggtgaagta       600
     atttggacgg tgagataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page