(data stored in ACNUC7421 zone)

EMBL: BA000007.PE282

BA000007.PE282       Location/Qualifiers
FT   CDS_pept        312998..313456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33715"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33715"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K4"
FT                   /protein_id="BAB33715.1"
FT                   /translation="MVRIYNSSLEVACRMAKVLVAIYPSSLSLERLICFDFILVNLKDF
FT                   LPEEISLHPPIPRRDAQLALKREIVLESLALLQGYELASKIYTHRGFVYKASEKTYAFT
FT                   NSLHNEYVAQMEHNINLVVKLYSDIPDEQLQSIIKNKIGKYDMEFNYE"
     atggttagaa tttataattc aagtttagaa gtggcatgtc gaatggcgaa agtgctcgtc        60
     gctatttatc cttcttcatt aagccttgaa cggcttattt gttttgattt tattttagta       120
     aatcttaagg attttttacc tgaagagatt agtcttcatc ctccaatacc ccgtagagat       180
     gctcagttag ccctaaaacg agagattgtt ttagaatcat tggctttgtt gcaaggctat       240
     gaactagcct caaaaattta tacacatcgt ggttttgtat ataaagcttc tgaaaaaaca       300
     tatgcattta caaattctct acataatgaa tatgttgcgc agatggagca taatataaat       360
     ttggtggtta agttatatag tgatattcct gatgagcagt tgcaatcaat tataaaaaat       420
     aaaattggca aatatgatat ggaatttaat tatgaatga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page