(data stored in ACNUC7421 zone)

EMBL: BA000007.PE285

BA000007.PE285       Location/Qualifiers
FT   CDS_pept        complement(315956..316507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0297"
FT                   /product="phage polarity suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33720"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7J0"
FT                   /protein_id="BAB33720.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
     atgatggccc gagtcactcc agaccaagcg cttatcagtt ttagaaatgc ccgtattctg        60
     tgggctggac atagtgagag ccgaaaagcc gttgaacaac agatagaatc actcctcact       120
     gccatggaaa aaccagcaga ttatgctcga cagctcgaat tacagcggga acatctggat       180
     gtgctgaaat ggcaaattaa ctgtgctgcg cgcgaatgca tttactcgca gcatcaactg       240
     atggaggcct gcacagaaga cgctctcagc aattttatgc aggcgaatgg agcagccctg       300
     acatctgcac tggctccgtt cctgaagggg cgcggagggg ttgacgttgc gtcccgtata       360
     ttacgcaatg ctctggttcg ccagctggca ataacaccgc ctgaaattgc cggggattat       420
     cgtatgattc tggatgaatc cggtgtgatg cctgacccca tgatggttcg tgattgccag       480
     agctcttaca cccctgcaca acaactgcgc tttcagcaac gtctggatta cattaacggc       540
     atgcaggagt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page