(data stored in ACNUC7421 zone)

EMBL: BA000007.PE286

BA000007.PE286       Location/Qualifiers
FT   CDS_pept        complement(316504..317256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0298"
FT                   /product="phage capsid size determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33721"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I9"
FT                   /protein_id="BAB33721.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
     atgacaatcc cagaacagaa caataacccg atcgttgaaa tttctatccc tgtttcgacg        60
     caacaggcgc ttgagaaagt gaatgccacc aaatctgcat ggcttgaagc acgtcgtcag       120
     caaaaagcgg cagcggataa tattgcgaca atccgccagc gccgcgctga aatggaagcc       180
     acgacgaacg ccctgaatga ggagtggcgc acgctatttc gtgaaagtca gggcgtagtc       240
     tcaaaggaaa tgaaaaaact gcgcacggaa attgcgctgg gacgagaaac gcttgaggat       300
     tttgatgagc tgctggcggc tcaggaaagc gaaaatgcac ttttgccgca ggaggctgcg       360
     gaattagccg gaaagtatat ccacgcgcac gacacccttg tgggtattcg cgcaaaacaa       420
     atctgggaag attttatgca gtcgcatgga aaagcactaa tccagacact aagcctgctc       480
     aaatcaacaa tgggcaggga agccagcgca gttgtcggtg tggtgcattc agttaatgac       540
     ccggacacac tgctgaaaga ttttattcat aaacatatca ccagaccggc tctgactaac       600
     gatgcgatgc ccgaacagga ccccgtgttt aaactggcgg gagttgcccc ggattatgcg       660
     gcccgtctgg atttcagtaa taaactctct ccagcagcta tgcataaaat gaaggttcgt       720
     caggaacgtg ctgagaagga gaaagcagta tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page