(data stored in ACNUC7421 zone)

EMBL: BA000007.PE288

BA000007.PE288       Location/Qualifiers
FT   CDS_pept        318447..319004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0300"
FT                   /product="phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33723"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33723"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I7"
FT                   /protein_id="BAB33723.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTHPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
     atgatgatac ctgcatacat taaatacctt tattctggct tgcttactgt cgtcatttcc        60
     aggtatagtt tttccgctgt cgcaaaatcg gcagccggaa ttggcgttcc gtataactta       120
     ttggcgacaa ttgacgcccc ttgcgtcttt ttttacgtcg tagctcaggc acaaccattt       180
     tcagggctgt ggtgtttatg cttacaccat ggttctatcg agataatggt agtccgggcg       240
     gggcagcctt cgggctggcc ggtttccaat aaggccggtt acgccaaccc cgttcgggct       300
     gccaccagtg aaattggcgt ttccggtggt agcaataacc gctacttatt ggaggctgcc       360
     atcatggcta caatcctcac cccgtcacac ccgcaatatg tctttgtgtt tgccgcaatc       420
     cgccgtgctg acactcaccc ccgcatctgt atgcttcgca ctgtctcctg cgatgagcgt       480
     tccgcgcgcc gtttgctagt ccgagattat gtactctccc tttctgcacg gctgcctgcc       540
     ggggaggtga cgctatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page