(data stored in ACNUC7421 zone)

EMBL: BA000007.PE290

BA000007.PE290       Location/Qualifiers
FT   CDS_pept        319222..319545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33725"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33725"
FT                   /db_xref="GOA:Q8X7I6"
FT                   /db_xref="InterPro:IPR035317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I6"
FT                   /protein_id="BAB33725.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
     atgatatgct gtgaatctct tctggcactt cgtgccgctc tgtatcgccg tgccgttgcc        60
     tgtgcctggc tggctctaag caatcatcag gaacgttatt ccggcctgac gctcgctgaa       120
     cttgaagatg ccatagcccg cgagctggaa gggttctatc tgcgccagca tgggcagcaa       180
     agagggctgg aaattgcctg cgcgttgctt tcggatctga tggagtcggg gccgcttaaa       240
     gcctgtccgg ttctctcact gctcggaatg acggtcatgg atgaactttg ttcccgtcac       300
     ctcaacaaac cagcgctgca ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page