(data stored in ACNUC7421 zone)

EMBL: BA000007.PE292

BA000007.PE292       Location/Qualifiers
FT   CDS_pept        complement(322025..322981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I4"
FT                   /protein_id="BAB33727.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWDFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
     gtgactagtt attcaaactt ttccaatcaa ataaaagaaa ccatcaataa taaattcgat        60
     catgaaattc atgattggga cattataaaa aactcaatca caactttaat aaataaaaat       120
     atccatggtg caggtagaaa tatcgttgat tttatagatt taggtaactg ggattttatt       180
     tcaaactttt cctttgatga ctctacaaga agacttgaat tagagtggca ccccaatgat       240
     aaattccata tatatattga gtccgttgtg tttgtcgagt ttaatgacac tatatatgct       300
     ttcttaaagg gatactatca caatcagtta tctctaaata gaatatataa tacaaaatgc       360
     tcttcatgtt catttgaaaa ctcaggttct tatatggtag acgtttatag aacggttaaa       420
     agagtaaatg agacaatcca gaccccaaat ataaattgct atactacatg tattttaaca       480
     aggcccgcaa atggtcatgt tacatctaca ggcttctcac gaaacctcat ggatgcgata       540
     aatatttcat tagcagagca caaaatagcc tctttacata atgaagtcat gagtattgag       600
     gaatatgatc gtgattcttt acaagagaaa ggaaatactg ccaggagata tttagaatat       660
     attctcatgc ttgttaatat tcgtataatg catttaaaca acgttcaata ccaagagcaa       720
     atgctaggta gtttagtttc tgttattgag gctctggact atgaaccatt aatgaaaaat       780
     gatgttgaaa ttacaaagga catccttaat gcttgcagcc accacggggg ggttagaatt       840
     gaaaagaaag atgtaatttt ttctttggaa gttattgaaa acttaattaa agccataaag       900
     aaaaccgaca taaataaatt acaactcgat gggatgttta aatcaattca aaaataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page