(data stored in ACNUC7421 zone)

EMBL: BA000007.PE295

BA000007.PE295       Location/Qualifiers
FT   CDS_pept        325544..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0307"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33730"
FT                   /db_xref="GOA:Q8X6K0"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6K0"
FT                   /protein_id="BAB33730.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
     atgtctttat atataaaact catcctctca attgtcaggg aaattagcgt gaatactatc        60
     tgttctttaa ttgttgtggt tgcactgtct ttattatcat tcagtagcgt cgccaaaacg       120
     attactgccg tcggttcaac cattaacagc actgaaaaag aaatttcttt acaggcagaa       180
     aaacaaggga aatcatataa aattctgggc gcgtttttta agaacagagt ttatatgata       240
     gcaaagttaa caccagtcag taaaaatgat gcttcataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page