(data stored in ACNUC7421 zone)

EMBL: BA000007.PE297

BA000007.PE297       Location/Qualifiers
FT   CDS_pept        327673..328731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33733"
FT                   /db_xref="GOA:Q8X6J7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6J7"
FT                   /protein_id="BAB33733.2"
FT                   /translation="MSYADSTNPNAPVSMTDKWDKTFAESQKVDHRKVSFPNRYGITLV
FT                   GDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGLYAQTLAERGFVTLAFDPSYTGESGGY
FT                   PRNVASPDINTEDFSAAVDFLGLQKEVDRNRIGLLGICGWGGMALNDAAMDTRVKAVAT
FT                   SVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYLNEQRWKDAQSGTFAHGGHDINVDSNG
FT                   KVSAGERILPETLPANPHPVLKEFFDYYRMPRGFHERSVNSTGAWTATMPLSFMNMPLL
FT                   SYASEITIPTLIVTGEKAHSRYFAEDAYKAVGSKDKELVVVPGANHVDLYDNVAGKIPF
FT                   AKFEQFFQTKLK"
     atgagttatg ctgattcaac caatcctaat gcccctgtgt ccatgaccga taaatgggat        60
     aaaacgttcg ccgagagcca gaaagtcgat caccgtaaag tctcgttccc gaaccgatat       120
     ggcatcacct tagtgggcga tctttacctg cctaaagacc gtggcgatcg caagctggcg       180
     gcgattgcgg tcagtgggcc atttggcgcg gtgaaagagc aatccagcgg cttgtatgcg       240
     cagacgctgg cggaacgagg gtttgttacc ctggcgttcg atccttctta caccggggaa       300
     agcggcggct atccgcgaaa tgtcgcctca ccggatatca acactgaaga tttcagcgcg       360
     gcggtggatt tcttagggct gcaaaaagag gtagatcgca accgtatcgg gctgctcggt       420
     atttgtggct ggggcggcat ggcgctgaac gacgcggcga tggatacccg cgttaaagcg       480
     gttgctacca gcgtgatgta tgacatgagc cgggcgatgg gccatggtgt gggggatggc       540
     gaagaccgtt attctaccgc cgaccgtcgt gctgttctgc aatatttgaa tgaacagcgc       600
     tggaaggatg cgcagagcgg aacgttcgct cacggtggtc atgatattaa tgtcgatagc       660
     aacggcaagg tcagtgcggg cgagcgcatt ctgccagaaa cgctgccggc aaatcctcat       720
     ccggtactga aagagttctt tgactactat cgcatgccgc gcggcttcca cgaacgttcc       780
     gttaactcta ccggggcgtg gacggcaacg atgccgctgt catttatgaa tatgccgctg       840
     ttgagctacg ccagtgaaat caccattccg acgctgattg tgaccggtga gaaagcacat       900
     tcacgctatt ttgctgaaga tgcttacaag gcggttggca gtaaagacaa agagttggtg       960
     gtggtaccag gggcaaatca cgtggacctg tacgataacg tggccggaaa aatacctttc      1020
     gcgaagttcg aacaattttt ccagaccaaa ctgaaataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page