(data stored in ACNUC7421 zone)

EMBL: BA000007.PE298

BA000007.PE298       Location/Qualifiers
FT   CDS_pept        328873..330000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0311"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33734"
FT                   /db_xref="GOA:Q8X4N6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4N6"
FT                   /protein_id="BAB33734.2"
FT                   /translation="MTLCVFVLIASEFMPVSLLTPIARDLGVTEGLAGRGIAISGALAV
FT                   LTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALATSYLMYMVGRAMIGVAIGGFWSM
FT                   SAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGSYLGATVGWRGAFLCLVPMAVVA
FT                   FIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMIACGLFFMGQFALFTYVRPFLES
FT                   VTRVNSLGLSLILLIIGVAGFIGTLVVSIFLNRKCYPTLMAIPGLMAVIAIGLMLTGHH
FT                   VWMVSLLLGLWGMLATAAPTGWWTWIARTLPDNAEAGGGLMVAVIQLSIALGSTAGGIV
FT                   FDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
     atgaccctgt gcgtgtttgt gctgattgct tctgaattta tgcccgtcag cctgctcacg        60
     ccgattgccc gtgacctggg cgtgacggag gggctggcag ggcgggggat tgctatctcc       120
     ggtgcgctgg cggttctgac cagcctgacg ctttcaacgc tagctggaaa gatgaatcgt       180
     aagttcctgc tgctggggat gacggttctg atggccgtat cggggcttat tattgcgctg       240
     gctaccagtt atctgatgta tatggtcggt cgtgcgatga ttggtgtggc cattggcgga       300
     ttctggtcga tgtcagcggc aacggcgatt cgtctggtgc cgcagcatca ggtcacgcgt       360
     gcgctggcga ttttcaacgc cggtaatgcg ctggcgacgg tcgtggccgc gccgctggga       420
     agctatctgg gggctacggt cggatggcga ggcgctttct tgtgcttggt gcccatggcg       480
     gttgtcgcct ttatctggca gtgcattagt ctgcccagca tggatgcgaa taaaagccac       540
     acgtcatgtg gcgcggtatt ccgcttattt agccgccgca tggttgtggt cggcatgata       600
     gcttgtggcc tgtttttcat ggggcagttt gcgctattca cctatgtgcg cccatttctg       660
     gagtcggtga cacgggttaa ttccttaggc ttgtcgttga ttttgctgat tatcggcgtg       720
     gccggtttta ttggcacgct ggttgtttcg atatttctca acagaaaatg ctaccccacg       780
     ctgatggcca tacccggact gatggccgtc attgccatcg gtctgatgct taccgggcat       840
     cacgtctgga tggtctcgct gctgttagga ctctggggca tgctggccac cgccgcgcca       900
     accggatggt ggacatggat tgcgcgtacg ttgcctgaca acgccgaagc cggaggcggg       960
     ctcatggtcg cggtgattca gctctcaatc gcccttggat caacggcagg aggcatcgtg      1020
     tttgaccgcc ttggctggca gagtacgttt gccatgagta gtgtgctgct cctttgcgcg      1080
     ggcgtactga cctttgttac agcacgccag aaggccggtg cgctttag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page