(data stored in ACNUC7421 zone)

EMBL: BA000007.PE319

BA000007.PE319       Location/Qualifiers
FT   CDS_pept        complement(352242..352598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33757"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G9"
FT                   /protein_id="BAB33757.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
     atgaataaga atctcatcct cgcatttgca ttattttcct tacctgtatt tgcagaagaa        60
     gatctggggc caggcaaata tgtttgtgac attaggattt ccagcctgga taccgctact       120
     caaattctgt caaaatccgc aacagttctc gataatggaa acaatttcat cgttcaaatg       180
     ccaaatggag atcaattgta ctctccagat ctggaaaatg ttgatgatgg tataaaacaa       240
     aaagcaacaa taggtggagt gacatttatt cgtcgtccaa cttttaacga tcgcttcatc       300
     gtggaagatg gaaatacagg attcttctat aagatgcgaa actgcgagaa gaaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page