(data stored in ACNUC7421 zone)

EMBL: BA000007.PE336

BA000007.PE336       Location/Qualifiers
FT   CDS_pept        372408..372542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33779"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFR4"
FT                   /protein_id="BAB33779.1"
FT                   /translation="MCVTSNVLVMFSSFEIFDVISYKVVFIVYLIDFICILSFNEVIV"
     atgtgtgtta cgtctaatgt tttagtgatg tttagtagtt ttgagatatt tgatgttatt        60
     tcttataagg ttgtttttat tgtttatctt attgatttta tatgcatttt gtcgttcaat       120
     gaagttattg tgtag                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page