(data stored in ACNUC7421 zone)

EMBL: BA000007.PE352

BA000007.PE352       Location/Qualifiers
FT   CDS_pept        394397..394807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_5377"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3L2"
FT                   /protein_id="BBE29396.1"
FT                   /translation="MTIKEKFSQKYPHASFCTFGDSAALADHLATLIATGVKTASCGSL
FT                   AGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARKEGEGDLSLEY
FT                   WRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
     atgaccataa aagaaaaatt ctcacaaaaa tatccccatg cttccttttg tacttttggc        60
     gattcagccg cgttggccga tcacctcgca acgttgattg cgactggtgt taaaacagct       120
     tcctgtggtt cgctggcggg atgtattgaa gacaacgcat ttccgatgat tggtgagtat       180
     aagattgtag aaaatagccg tggtgagcct gtatgtgtta tcagagtgat tggcctgcat       240
     ttactgcgct tttctgatgt caccgcggag cttgcccgta aggaaggtga aggtgacctc       300
     agtcttgaat attggcgtaa tgaacaccgt cgttttttcc aggcagaagg aagctattca       360
     ccagaaatgg acgttatctt tgaagaatat gcccttattg acgttgtgta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page