(data stored in ACNUC7421 zone)

EMBL: BA000007.PE353

BA000007.PE353       Location/Qualifiers
FT   CDS_pept        395058..396044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0374"
FT                   /product="sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33797"
FT                   /db_xref="GOA:Q8X6A6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A6"
FT                   /protein_id="BAB33797.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDVSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
     atgatgaata aacgttttgt tatcaatatg gtgtcttcgc tgttattagg cgctgcgcta        60
     atttctgcgc cgctccaggc agcggaaaaa gtcgtggtga atatttctaa agtcgatggt       120
     atgccgtggt ttaatcgcat gggcgaaggt gtggttgagg cgggtaaagc ctttggtgtt       180
     aatgcctcac aggtggggcc ttcaagtact gatgctccgc aacaagttaa aattattgag       240
     gatttaatcg cccgtaaggt taatgcaatt actatcgtgc caaacgatgc caacgtgctg       300
     gaaccggtat tcaaaaaagc gcgagatgcc ggaattgtgg ttctgaccaa cgaatccccc       360
     ggtcagccaa gtgctaactg ggatatcgaa atcattgata acgaaaaatt tgccgctgaa       420
     tatgttgagc atatggcgaa acgcatgggt ggcaagggcg gctatgtgat ttacgtgggt       480
     agtttgaccg tgccgcagca taacttatgg gctgacttgc tggtgaaata ccagaaagag       540
     cattacccgg atatgcatga agttacccgc cgcatgccgg ttgccgagag tgtggatgtc       600
     tcacgtcgta ctacactgga cctgatgaaa acctatcctg acttgaaagc ggttgtctcc       660
     tttggttcaa acggtccgat tggcgcggga cgtgcggtga aagagaaacg ggcgaaaaat       720
     aaagtcgcag tctatggcat gatgatccct tcacaggcgg catcactgat taaaagtggt       780
     gatatcaccg aagggattac ttacgatccg gcctctgcag gttacgcact cgcagccgtc       840
     gccagcacgt tgctgaaggg tgaagagatc aagcctggat tagaaatgca gaatctgggt       900
     aaggccgacg tagatatgga taagcgaatt atccgtttcc ataaggtatt actggtcaac       960
     aaagacaata tcgactcact ttattaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page