(data stored in ACNUC7421 zone)

EMBL: BA000007.PE377

BA000007.PE377       Location/Qualifiers
FT   CDS_pept        complement(425297..426073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33823"
FT                   /db_xref="GOA:Q8X682"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X682"
FT                   /protein_id="BAB33823.2"
FT                   /translation="MKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARAEIRN
FT                   PTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNKQGFT
FT                   HLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLYLAGD
FT                   TLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIATHME
FT                   AVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
     atgaaaatta cgcaaattcg taatgccacc caaattatcc aatacgctgg caaaacattt        60
     cttatcgacc cgttactcgc gcctaaagga agttatccgg gttttgccgg aacggcacgc       120
     gcagaaatcc gcaatccaac ggtagaatta ccgtgcgatt taacaacgtt actcaacgtt       180
     gacgccctaa tcgtgaccca tttgcatgaa gatcactggg acgaaacagc ctcccgcgtc       240
     gtccctaaag ataaactgat ttatgtgcaa aatgagcaag atgctgaatc actgaataaa       300
     caaggattta cgcatcttac cgtacttacc gacgagacta aatttggcga tattactctg       360
     cataaaacga cagggcagca cggctccgat cgcacctatg ccgacccggc gatggcgaag       420
     cgtttaggcg cagcttgcgg cgttgttttc cagcacccga cagagaaaac gctctatctg       480
     gctggcgata ccctctggcg tgacgacgtc gaggctacaa tgctaacttt ccaaccagaa       540
     gtggttgtgt tgaatgccgg atttgcgcat gttctggggc atggcgcgat aattatggga       600
     gcagaagata ttctcaaaac acattttacc ctcccagaag cgcaaattat cgcgacacat       660
     atggaggccg taaaccactg tttgctgacg cgtgatgcgc tcaaggaata cgccagagat       720
     aatcaaatta tcgaatttgt gaacgtacca gaagatggtg aaacgttgac attctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page