(data stored in ACNUC7421 zone)

EMBL: BA000007.PE392

BA000007.PE392       Location/Qualifiers
FT   CDS_pept        complement(441345..442376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0415"
FT                   /product="periplasmic-iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33838"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J1"
FT                   /protein_id="BAB33838.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
     atgaaaatga cctttacctc tactctgatt gcttctgccg ttgcgctggc gactttaacg        60
     ggtgccgcgc aggcaaaagg ccggctggtg gtctattgca gcgccaccaa tgaaatgtgt       120
     gaggccgaaa ccaaagcgtt tggcgagaaa tatgatgtaa aaacctcgtt tatccgcaac       180
     ggttccggaa gcaccctggc aaaagtcgat gctgaaaaga aaaaccccca ggctgacgtc       240
     tggtacggcg gcactttaga cccgcaatcg caggctggcg agatgggcct gctacaggcg       300
     tataaatccc ctaaccttga gcagatcatg gagaaattcc gcgatccggc aaaagtgaaa       360
     gggaatctgt cctctgccgt ttatgtgggg atcctcggtt ttggcgtaaa caccgatcgt       420
     ctgaaagaga aaaacctgcc ggtgccgaag tgctggaaag atctcaccaa accggaatat       480
     aaaggcgaaa ttcaaattgc cgatccgcaa agttccggta ctgcctacac cgccctggct       540
     acttttgcgc agctgtgggg ggaagatcag gcctttgatt atctaaaaca actgaacgcc       600
     aacgtctctc agtacaccaa atcaggcata gccccggcac gtaacgccgc ccgtggcgaa       660
     acggcgattg gtattggctt cctgcatgac tactcgctgg aaaaagaaca gggcgcgccg       720
     ctggagttga tttccccgtg tgaaggtacg ggctacgaaa ttggcggcgt cagcattctg       780
     aaaggcgcgc gcaacctcga caacgccaaa ctgtttgtgg actgggtatt atcaaaagaa       840
     gctcaggaac tggcgtggaa gaaagggaag tcttatcaga tcctgactaa taccaccgcc       900
     gaaacgtcgc caaattcgct gaagctcgac gacctgaaat taatcaacta cgacatggat       960
     aaatatggtt ccacggatgt tcgtaaggca ttgattaata aatgggtcag cgaagtgaag      1020
     atgggtaaat aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page