(data stored in ACNUC7421 zone)

EMBL: BA000007.PE393

BA000007.PE393       Location/Qualifiers
FT   CDS_pept        complement(442373..443677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0416"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33839"
FT                   /db_xref="GOA:Q8X5J0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J0"
FT                   /protein_id="BAB33839.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
     atgcacgcgc gttcagcgag agaaattaat caatgctacc ggacattacg tccgcgattg        60
     ctgatgtgca tgattattgg ctacgccgca ttttatctga cgcgaaaaag cgtgaattac       120
     gtccttccgg cgctacaaac cgacctcgga ctggataaag gcgacattgg cctgctgggt       180
     tcgctgtttt atctcagcta cggattgtcg aaatttaccg ccggactgtg gcatgacagc       240
     cacggacaac gcggttttat gggcgtcggc ttgttcgcca ccgggttatt gaacgtggtg       300
     tttgcctttg gcgaatcact tacgcttctg cttgtggtct ggacactgaa cggttttttt       360
     cagggctggg gatggccacc gtgtgcccgc ttgctgaccc actggtactc acgcaatgag       420
     cgcggtttct ggtggggctg ctggaatatg tcgatcaaca ttggcggagc gattattccg       480
     ctgattagcg cctttgccgc ccactggtgg ggctggcagg ccgcgatgct gacaccgggg       540
     ataatcagca tggcattagg gatctggtta acgctacaac tcaaaggcac gccccaggaa       600
     gagggattac cgacagttgg tcactggcgt cacgatccgc tggagttacg tcaggaacaa       660
     caaagtccgc cgatggggct gtggcaaatg ttgcgcacca ccatgctgca aaatccgctg       720
     atctggctac tgggcgtctc atatgtactg gtttatgtga tccggattgc gcttaacgac       780
     tggggcaata tctggctgac ggaaagccac ggtgtcaacc tgctcagcgc caacgccacg       840
     gtaatgctgt ttgaagtggg cggcttactc ggcgcgttat ttgccggatg gggatcggat       900
     ttgctgttta gcgggcaacg agcgccaatg attttgctgt tcacgttggg gttgatggtg       960
     tcagtcgccg cactgtggct ggcaccggtt catcactacg ctctgctggc agtgtgcttt      1020
     tttaccgtgg gctttttcgt ctttggccca caaatgctga ttggacttgc ggcggtggag      1080
     tgtgggcaca aagctgcggc gggttcaatc accggatttc tcggcctgtt cgcttacctt      1140
     ggcgcggcgc tggcaggctg gccgctgtcg ctggtcatcg aacgctacgg ctggccggga      1200
     atgttcagtt tactctcggt cgccgcagta cttatgggtt tactgctgat gccgttactg      1260
     atggcgggca tcaccaccac tcacgctcga aggataaaac aatga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page