(data stored in ACNUC7421 zone)

EMBL: BA000007.PE394

BA000007.PE394       Location/Qualifiers
FT   CDS_pept        complement(443762..445303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0417"
FT                   /product="sensor histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33840"
FT                   /db_xref="GOA:Q8X5I9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I9"
FT                   /protein_id="BAB33840.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
     atgtcgcgca atcttcgtca ttgggtgatt ttgctgttta ttgtgctagc ctggggaacc        60
     ggctggctga tgctgtggac gctcagcttt tatctgacca ataacggtca acaggcggtg       120
     ttgtttctcc cgcagggagt ttatctcgcc cttgttattt tgctctctcg ccgctactgg       180
     cctgcgttgg tgctcccccc tttgctgatg atgttctggc tccatagtga acagctattg       240
     aacggttatc tcatgctggc aacgccggtt attagcctgt ttcctgccct ccttgcgcaa       300
     aacttctggc accgttttcc actttactgg cagcgtctga cgttgctgtt agccactgtc       360
     acggcagctt cattgttgaa taccgccctg ctctcccctt ttatgtcagg cccaataatg       420
     ctaccgggtt tgacctcatt taccggcggc gtattactga cgccgtttgt ctatcttatc       480
     tttgagtttc tgcgccagca gcatcgctac cagctcctgg gactcgatac gcataatccc       540
     cccttgcgta cctctttaat catctggtgt agcctgtttt ttattattgg tatcggcact       600
     cagatggtgc tgtcacctga aattgaacgt ctgctgttga tcgtggtctt tttgcccaat       660
     gtggtgatgg cgtggaaatt tggctggcaa ggtggcgtac tctccgggct tttgggcagc       720
     atgatgatca ccatcgcccg ccagattggc gtgggcttta gtaacctggt ggagctggag       780
     attttcctcg cgacccaggc cttgctggga attggcctgg gcattgccat cagtcgccag       840
     caacatctgg cgctaaacct gcaccattac cgacaacggc tggaggccga gctggcagcg       900
     cggcgggcat tggcggaaaa gctgatccac accgaggagg acacgcgaaa aaacctggcg       960
     cgagagctgc acgacgaaat cggtcagaac atcaccgcca ttcagatcca gtcgcaactg      1020
     gtgaagcggg cgcgtgatcc ggcgcaaatt caatccgcag ccagccaaat caatgagctc      1080
     gcccgccgca ttcatctctc cacccgccaa ttgctgcgcc agttgcggcc tcccgcgctt      1140
     gatgaactga catttcgcga agcgttgctg catctgatta atgaatttgc ctttagtgaa      1200
     cgcggcattc attgccagtt tgcctatcaa ctgaactcca caccagaaaa cgaaacggtg      1260
     cgctttacct tgtatcggtt attgcaggag ttgctcaata acatctgtaa acacgccgaa      1320
     gccagcgaag tgacgattat cctgcgccag cagggagagg tattgcatct ggaagtcagc      1380
     gacaacggtg tggggatcgc cagcgggaaa atggctggat ttggcattca ggggatgcgt      1440
     gagcgcgtca gcgccctggg cggcgactta acgctcgaaa aacagcacgg cacgcgggta      1500
     attgttaact tgcccacatt tttgcaacaa atcgccggat aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page