(data stored in ACNUC7421 zone)

EMBL: BA000007.PE420

BA000007.PE420       Location/Qualifiers
FT   CDS_pept        470661..471110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA3"
FT                   /protein_id="BAB33866.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKNYCPP"
     atgacacaac gcccctggag caagttacag cgggagatct atgacttact gacgccaacg        60
     atcaacctgc aaattcactg tacccgttat cccatgcgca gccaaaatgg tggaagcacc       120
     gatttaccgc gttattggat cacgttggat aaaaacgtga tctgggatta cccgaaagac       180
     tttattgcag gcaacggtgg agtgcgtaat tttcacggtg aaacttgctg gtatccttac       240
     ctgacggata tttgttcaat ttctgattta ttgcgtgaat atattgacac cccaaaagcg       300
     gagttgttaa caaaacaatt taccagcgat aaatgggggt tagtgaatat tctgcgtgct       360
     gctgacaggc gaatagggat gaggcgatta gatcagttac ggcgtaaaac gcataatatt       420
     gctgcgctaa aaaattattg cccgccgtag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page