(data stored in ACNUC7421 zone)

EMBL: BA000007.PE431

BA000007.PE431       Location/Qualifiers
FT   CDS_pept        486502..487947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33877"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE97"
FT                   /protein_id="BAB33877.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGVLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
     atgacaattt caaattcgaa tttattgaaa ccgtttatta ctggtactga gttgccacct        60
     tttaaagagg atgtcttttc taaaacagaa gaacaattta aaaaaagcac ctatggcaaa       120
     tcgcttttca tttccggaaa tgaaaactta gtaaacattt cagcggaaaa aatcgatgaa       180
     ataaaaaata gcaaaaattt cttttcaaac attgtaaata taataatttt actcattaag       240
     catcctgata aaattctgcc cattcttcat ggttgtcctg tagagtcgat cgaagtcatt       300
     aagaatgcga aacgaacggg acaatggtca tatgagatga ctgataagaa cgggcagagt       360
     attgaagtgt cctatatttt cactgatacc atagatgata aatctgatgg aaaattatgc       420
     ttaaaaatct gtaactcctg caaccaaaat gattctagta cacatgaata taaaatagat       480
     catcaacagt tgaaaaatca cataaggcaa cttgaggagt gggcccttct tgaaaagttt       540
     tatgataaca acgcttatta ttctaaacgt acaaaacaat tagagaagaa aattgccgat       600
     gcggggttta taacaaggaa ggttaaagcc gagaacttta atgtaaaaga gtttaaagac       660
     gatatagcct cgatgctttg tgaacagccc cccatgcgta cacaccagat ttcttcatcc       720
     ggatacgtat ctgccgataa actgcacaaa ctctataaga caaatttgga agacgcgcag       780
     agagatctga aaacaacacc ggttgacatc gatggtgtta gtctaaaatc aataactcgg       840
     gaaaaaattg cggaagaaat tgcgaaaaaa actgcggaaa taattgcgaa acaaaatgcg       900
     aagagcattg aggagaagaa tattgaaaaa aacaagaaac aaacaaattc tgaggataat       960
     tttgtcttaa aattctcacc ggaagaaatc aatgagatgc tcctggatta cagcgatgaa      1020
     gaacaaaaaa aattaagacc ttttttcact agtgatcaca tctattgttt gtttgatgct      1080
     tttagtcagg gtttgcataa tgttgctcgt aatggcagtc cacggtatgc aggtttacta      1140
     cgtcaaatag catccaagtc tgcgatatta caagattttg atcaacaatt gttctggcgc      1200
     acgtttacag gaggggtcct ccatcgacat atctctgtga agagcgagcc agaaaagaca      1260
     gatgtatggc gattcagtag ccaatttgat tttccacata taaatgaaaa cggagagttg      1320
     tccagaacgg tactcatgtt cgagggggtt gctgaaagca actttaaaga tatcgccaat      1380
     cattccagcg aatgtttttc ttaccgttgt tatgccgccc cgctggatgc gaatgctaaa      1440
     aaatag                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page