(data stored in ACNUC7421 zone)

EMBL: BA000007.PE439

BA000007.PE439       Location/Qualifiers
FT   CDS_pept        494492..494773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0462"
FT                   /product="plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33885"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE95"
FT                   /protein_id="BAB33885.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
     gtgtataagc ttagcggaaa agctgttgaa gatttcagag ggatctatga ctacacgctg        60
     ggaaagtttg gtgatgagca ggcggatcgc tataccgact ctctcggcac ttttctggat       120
     acactctctc aaatgcccga gatagggcaa gactatgatg cgattccaga ggtaaagaag       180
     atcgcattta ggtttcacac tgtttattac gttataagag tcgatgacat tctcattgcg       240
     cgcattcttc atcagttgat ggaacctcgc cgtcactggt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page