(data stored in ACNUC7421 zone)

EMBL: BA000007.PE50

BA000007.PE50        Location/Qualifiers
FT   CDS_pept        55039..55353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0053"
FT                   /product="CcdB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33476"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33476"
FT                   /db_xref="GOA:Q8XA16"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA16"
FT                   /protein_id="BAB33476.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
     atgcaattta cggtataccg cagtcgcagc aggaacgccg cgtttccctt tgttatcgat        60
     gttaccagcg acattattgg tgtgattaat cgccgtattg ttattccatt aacacctatt       120
     gaacgattta gccgtattcg cccaccagaa cggcttaacc caatcctttt actggtagac       180
     ggcaaagaat atgtgctcat gacgcatgag actgcaactg ttccagttaa cgcgctggga       240
     acgaaatttt gcgatgccag cgcgcaccga acgttgatta aaggagcatt agattttatg       300
     ctcgacggga tttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page