(data stored in ACNUC7421 zone)

EMBL: BA000007.PE517

BA000007.PE517       Location/Qualifiers
FT   CDS_pept        579896..581251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0540"
FT                   /product="outer membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33963"
FT                   /db_xref="GOA:Q8XD20"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD20"
FT                   /protein_id="BAB33963.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKT
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
     atggcgcgat tccagtttaa aaaccgtaaa aataatggac ttattttttt tataagtttt        60
     atggtgatgg gagaagctgc aattgctgca ccgctgccac aatgggcgaa tgccccagcg       120
     gtaacgccag ttgcccaatt atctttacag gaaagtatat tacgcgcctt tgcgcgaaat       180
     cccggtgtca ctcaacaggc ggcgcagata ggtattggcg aagcgcaaat tgatgaagcc       240
     aaaagtgcct ggtatccgca cgttggatta accggcaacg cggggccgtc ccgacaaacg       300
     gactccagcg gcaggcttga taacaacgtt tcgtatggca taaccctgac acaactggtg       360
     tatgactttg gtaaaactaa caacgatatc aatctgcaaa ctgccgcccg tgacagctac       420
     cgctttaaat tgatggcaac cttaaccgat gttgcagaga aaacggcgac tgcctacatg       480
     gaagtcagtc gttatcaggc tttgtgcgat gcggctcaac gcaatattca ctcgctggaa       540
     aacgtctaca acatggcggc attgcgcgct aacgcaggcc tgaactcatc gtcggatgaa       600
     ttacaggccc agacgcgtat tgccggaatg cgctcaacgc tggagcaata tcaggcgcag       660
     atggcgagcg ccaaagcgca actggcggtg ctcactggcg tacagccgga ggcgatagcc       720
     gcgccacctg ctgaattagc cgagcagccg gtatcgctga agaatattga ttaccagtcc       780
     atcccgctgg tgctggcggc agaaaactta cgccagtcag cacagtacgg cgtggaaaaa       840
     acgaaagcgc aatactggcc aacgctcagt attcaggggg gtaaaacgcg ctaccagacc       900
     agcgaccgct cgtattggga tgatcagcta caactgaacg ttaacgcgcc gctgtatcag       960
     ggcggcgcgg tttctgccca ggtgcaacag gccgaagggc aacaaaaaat ctctgcctcg      1020
     caggtcgaac aggcaaaact ggatgtgctg caacgagcgt ctgtggcata tgcgaactgg      1080
     accggcgcac ggggtcgtga agaagccggt ttagcgcaat ccgaaagtgc gcacaaaacg      1140
     cgagatgtgt accaaaatga atataaattg ggtaaacgca gtctgaatga tctattaacc      1200
     gtcgaacaag atgtctttca ggcgcaatcg gctgaaataa atgccaatta tgatggctgg      1260
     gtcgccgccg taaattatgc cgctgcggtg aataacctta ttccattagc gggaattaaa      1320
     cagggcttat acaacgactt acccgacttg aaataa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page