(data stored in ACNUC7421 zone)

EMBL: BA000007.PE518

BA000007.PE518       Location/Qualifiers
FT   CDS_pept        581354..585739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK7"
FT                   /protein_id="BAB33964.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMQDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQAETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVEPGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   "
     atgagcctga ttattgatgt tatttcgcgt aaaacatccg tcaaacaaac gctgattaat        60
     cctggcgacg tcacggttgt tatttatgag ccttccgtgg tgcaggttca tgctcaggcc       120
     tctgccgttg cgcgttacgt ccgtgaagga aatgacctgc tgatctatat gcaggacggc       180
     acggtgatcc gctgcaacgg ttatttcctg caagcggcga atacagctga acaatcggaa       240
     ctggtgtttg ccgatggtca acagctaacc catatcacct ttgccgatac tgctgcgggt       300
     ggattagccc ccgtagaact gactgcccag accactgcga ttgaaagcat tgcgccattt       360
     cttgataccg ttgctcagac cagcgccttc ccgtggggtt ggctggcggg ggcggcggta       420
     ggtggtggcg cgcttggtgc actgctggca agcggtggcg atggcgactc gaaaacagaa       480
     gtgattaata accctacgcc acctgctgag cctggcaacg ccacaccatc atttttagtt       540
     accgataatc agggcgatca gcgcggcatt ctagccacca atgacatcac cgatgacacc       600
     acgccaacct ttagcggcag cgggcaggcg ggggcgacta ttcagattaa agacagtaac       660
     ggcaatacta ttgccagtac tcaggtagac aacaacggtc actggagtgt ctcgttaccc       720
     acgcaaagtg caggtgaaca tacctggtca gtggtgcaaa ttgtcggcag taccatcact       780
     gacgccggtt cgataacgtt aaccatcgac aatagtcagg ccagcgtgca ggttgccacc       840
     accgcaggcg ataacattat taacgccagc gaacaggccg ccgggtttac gctttctggc       900
     accagtagcc atctggcgca gggaacagaa ctcaccgtta cgctaaacgg caaaacctac       960
     acgaccagcg taggcgctaa cggtgcctgg agcgtgcagg tgccgaccgc cgatgcacag      1020
     gcgttaggcg aagggaatca ggcggtgctg gtcagtggga aagacgccac aggcaatacg      1080
     gtcaccggcg cgcagctact aacggtcgat acccaaccgc caacgcttgc catcaacacc      1140
     atcgctcagg acaacattat cagtgctgcg gaacataacg tcgcgctggt actgagcggc      1200
     acgtcgaatg cagaagcggg gcaaaccgta acactgaccg tcaacgggaa aagccataca      1260
     gcaaccgtcg gtagcgacgg aacctggcaa gtgacgctgc ctgccacgga agtccaggca      1320
     ctggcggagg gtaattacgc tgtcaatgcc agtgtcagcg atcgggcagg gaacaccacc      1380
     agccacagcg cgaatttcac ggtagacacc tcagcacccg tggtcagtgt taataccgtg      1440
     gcgggcgacg atattcttaa taatgccgag caggccgtcg cgcagatcat ctccggacaa      1500
     gtcagcggtg cttctccagg cgatacggta acggtgaaat tgggcactca tgtcctgacg      1560
     ggcatcgtgc tggcagatgg cagctggaat gtggcgctgg acccagcggt aacccgcacg      1620
     ctggatcgcg gagccaatac gattttcgtc accgtgacag atgctgcagg aaatactggc      1680
     gcggcgtctc gagcaatcac gctggtcggt gtttctccgt tgatcaccat taacaccgtc      1740
     tccggcgatg acattatcag tggcgcagaa aaaggtgcgc cactgaccct taccggtagc      1800
     actcaacagg ctgagacagg acaaaccgtc acagtaaccc tggctggaca gagttttacc      1860
     actaccgtgc aggccgatgg ctcctggagt ctgacggtac ctgccgccgc gatgggaaat      1920
     ctgcctgacg gcgcggtggc gattaccgct tctgtgacgg atctcagcgg caataccggc      1980
     aacacttccc gcaccattac cgtcgatagc caggccccgg ccttaagcat tgatccactg      2040
     accgctgata acatcattaa cgccgccgaa agcgggcagg atctgcccat caccggcacc      2100
     accgacgctc agccggggca gacggtgacc gttacgttaa atgggcagac gtatcagggc      2160
     gtcgtgcagc cagacggcac ctggagcgtg actgtgcccg ccgccaacgt gggcgcactg      2220
     gctgacggca acgctacggt caccgccagc gtgaacgatg tcgccggtaa tccgagcagc      2280
     gtttcacgcg tggcgctggt ggatgccacg ccgccggtgg taaccattaa tccggtggcg      2340
     accgataacg tcatcaacac gccggaacat gctcaggcgc aaatcatcag cggcacggtt      2400
     actggcgctc aggcgggcga tatcgtcacc gtgacgctga ataatgtgga ttacaccacg      2460
     gtggtggatg gttccggcaa ctggagtctg ggcgttccgg cctcggtggt cagtgggctg      2520
     gcggacggca gttatcctgt cagcgtctcg gtaaccgaca aagccggaaa cacgggcagc      2580
     cagtcattga ccgtcacggt caataccgcc gcgcccctta tcggcattaa cagcattgcg      2640
     ggcgatgatg tgattaacgc cagcgaaaaa ggggccgatc tccagattac cggcaccagc      2700
     gatcagcctg ttaacaccgc catcaccgtg acgctgaacg ggcaaaatta caccaccacg      2760
     accgacgcct ccggcaactg gagcgtcacc gttccggcat cggcggttac agcattaggc      2820
     caggccaact atacggtaac ggcggcggtg accagcgata tcggcaacag cgccactgcc      2880
     agccataacg tgctggtcga cagcgcgctg cccggtgtga ccattaatcc ggtggcaacc      2940
     gacgatatta ttaacgccgc cgaagcgggc gtggcgcaaa ccatcagcgg gcaggtgact      3000
     ggcgcggaag atggcgacac ggtaactatt acgttgggtg gtaatactta tacggcgacg      3060
     gtgggcagca atctcacctg gagcgtggac gttccagcgg cagatattca ggcgctggga      3120
     aatggcgatt taacggttaa tgcctcagtc accaatcaaa acggcaacac cggcagcggc      3180
     acgcgggata tcaccatcga cgccaatctg cccggcctgc gggtcgatac ggtggcgggc      3240
     gatgatgtgg tcaatatcat cgagcacggg caggcgctgg tggtcaccgg cagcagctcg      3300
     gggctggctg aaagcacgcc gcttaccgtt acgattaata atgtggaata caccactgcg      3360
     gtgcaggccg atggtagctg gagcgtgggc gtcacggcgg cgcaggttag cgcctggcct      3420
     gcggggacgg ttaatattgc cgtttcaggg gaaagtagcg ccggaaactc ggtgagcatt      3480
     acgcatccgg tgacggtgga tctcactccg gcagcgatca ccatcaacac catcgccacg      3540
     gacgatgtga ttaacgccgc agaaaaaggc gctgatttaa ccctttccgg caccaccact      3600
     aacgtagaac ccggtcaaac cgtcaccgtc acctttggcg ggaaaaatta cactgccagc      3660
     gtagcgagcg atggtagctg gactgccacc gtacccgccg ccgatctggc gtcattaccc      3720
     gagggcagcg cctccgcact ggccagcgtc agcaatatca acggcaatag cgcctcggcg      3780
     gtgcacaact acagcgtcga cagcagcgcg ccaaccatca ttatcaatac cgtcgccagc      3840
     gacaatatcg tcaacgccag cgaagccgat gcgggcgtga cggtgagcgg cagtaccacc      3900
     gccgaagcgg ggcagattgt tacgataacg cttaacagcc cgaccgtgca gacctatcag      3960
     gcaacggtgc aggcggacgg cagctggagc atcaatattc cggcggcaga tcttgaggca      4020
     ttgaccgatg gcagccacac cctgaccgcc acggtcaatg acaaagcggg caatccggcg      4080
     agcaccacgc ataatctggc ggtggatctc accgttccgg tgctgaccat caacaccatt      4140
     gcgggcgatg acattattaa cgccaccgaa cacgggcagg cgctggtgat ttccggttcc      4200
     agcaccggcg gagaagcggg ggatgtcgtc accgtcacgc taaacagtaa aacctacacc      4260
     accaccctgg acgcctccgg caactggagc gtcggcgttc cggcggcgga tgtcacggcg      4320
     cttggcagcg gcccgcaaac tgtcaccgcc acggttaccg atgcggcagg caacagcgac      4380
     aattag                                                                 4386
//

If you have problems or comments...

PBIL Back to PBIL home page