(data stored in ACNUC7421 zone)

EMBL: BA000007.PE519

BA000007.PE519       Location/Qualifiers
FT   CDS_pept        585947..601822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33965"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG23"
FT                   /protein_id="BAB33965.1"
FT                   /translation="MPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTI
FT                   NPVATDDIINAAESGNAQTISGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAA
FT                   DIQAIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQAL
FT                   VITGSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTN
FT                   TAGTTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVT
FT                   FGGKTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATA
FT                   PTLAINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVS
FT                   LPTADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEH
FT                   GQALVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITA
FT                   AITDAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTI
FT                   TVTLNGQNYTATTDSNGNWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVN
FT                   SALPAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLS
FT                   WSVDVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVIN
FT                   SIEHNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTV
FT                   NITVSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVE
FT                   AGQTVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADR
FT                   AYSVDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVL
FT                   ADGTWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALVVDITAPDLTINTVAGD
FT                   DIINAIEHGQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALA
FT                   TGSQTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINAAEIVVAQTISGQV
FT                   TGTAVAGNTVIVTIGGNQYNATVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNT
FT                   GTATHDIVIDANLPGLRVDTVAGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVT
FT                   YGATVLADGSWSVGVPVADVTNWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITI
FT                   NTLSTDDVINAAEKGSDLQLSGTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAV
FT                   DVATLPDGAANVQASVSNVAGNSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSAL
FT                   TISGTSTAEAGQTVTVTLNGVNYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDK
FT                   ARNSASATHNLTVDLAAPVVTINTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTI
FT                   GTTTYTTVLDANGNWSIGVPASVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAP
FT                   VLAINTIAVDDIINAAEKGADLAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTV
FT                   PASRVSALGEATYTVTAAATDADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAG
FT                   VEQTISGQVTGAAAGDTVTVTLGGATYTATVQANLSWSVDVPASALQELGNGELTISAS
FT                   VTNSVGNTGNGTREITIDANLPGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNV
FT                   TLTINGQTYVAAVLADGTWSVGVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVD
FT                   LSAVAVSINAITADDVINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGS
FT                   WSTSVPAADMAALRDGDASAQASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILN
FT                   AAEAGAALTITGSSTAEAGQTVTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASNYT
FT                   VNAAVSDKAGNPASVNHNLTVDTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAAT
FT                   GSTVTVTIGTNTFTTVLDASGNWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQ
FT                   VTVNTGLPTITFNAISGDNILNADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTD
FT                   ASGNWTLTVPVSDLAALGQANYTVSASATSAAGNTASSQANLLVDSGLPDVTINTVAGD
FT                   DIINAAEAGADQTISGVVTRAAAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALG
FT                   NGDLTITASVTNANGNTGSGTRDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGS
FT                   SGLNAGAVLTVTINSVAYSATVQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPV
FT                   SVSHPFTVDLTAVAISINTVASDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTY
FT                   TASVAANGSWSVNVPAADLATLPEGAANVQASVSSASGNSASATHAYSVDASAPTLTIN
FT                   TIASDDILNAAEAGSPLTISGTSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSAL
FT                   GALNASNYTVSATVNDKAGNPGSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVI
FT                   SGTSSGGEAGDVVSVVLNGKTYTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRA
FT                   GNSDDASRTVTVSLSAPVISINTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNG
FT                   QNYSATTDASGNWSVTVPASAVSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGI
FT                   TINPVATDDIINASEAGSAQTISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVP
FT                   AADWQALGNGELTVNASVTNAVGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQ
FT                   AQVITGSSSGFAAGTALTVVINNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSG
FT                   ANSAGTQTSITHPLTVDLTAVAISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVT
FT                   VTFGGKTYTTTVAANGSWSTTVPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDS
FT                   AAPTVTINTIASDNIINASEAAAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWS
FT                   LTLPASDLTALANNGYTLTATVSDLAGNLGSASKGVTVDTTAPVISFNTVAGDDVINNV
FT                   EHIQAQIISGTATGAVAGDRLVVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTI
FT                   SATITDSAGNSSTQTHNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATG
FT                   TVVTVLLNGKGYSATIQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNGNSSTQT
FT                   HNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATGTVVTVLLNGKGYSAT
FT                   IQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNSATASRSVAVDLTAPVISINTV
FT                   STDDRLNAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAANGTWALNVPAVDLAA
FT                   LGQGAQTITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDDIINNAEQLAGQTISG
FT                   TTTAEVGQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDGSYTISATVSDQAGNP
FT                   GSASRGVTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTAPVGQTLTLTLNGKTY
FT                   TTTVQTGGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSSNHTITVDLSAPAMGI
FT                   NIDSLQADTGLSASDFITSVSPVVVNGSLTAALASNETAQISIDGGTTWTTLTVTGTTW
FT                   RYNDSRTLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPAVKTIAISAITTDMGL
FT                   ITNDFVTSDTTLAVSGTLGATLSAGEFAQISLDGGVTWTTLTVVGTSWSYADGHTLTDG
FT                   TWNYTVRVVDLAGNVGQTATQNVVVDTTSPEAAKSITITGISDDTGTSSSDFITSDTTL
FT                   TVRGVLGAALGANEFAQISTDNGATWVNVTVAADSLNWSYVDGRTLTNGTTTWQVRVVD
FT                   LAGNVGATSSQSALIDTVNPAQVLTIASISTDTGSSATDFITSDTMLTLTGSLGAGLAS
FT                   GEVAQISLDSGATWTTLTTNGTQWTYTDSRTLTDGSYVYQVRVLDLAGNTGPVVSKTVV
FT                   VDTINPTATPTIVSYTDDVGQRQGTLSSSQATDDTTPLLNGVLSAPLASGEVVYLYRNG
FT                   LLLGAVTMVGALNWTYSDSGLVSGAYTYSARVVDLAGNITSSSDFVLTVDTSIPTTLAQ
FT                   ITSQTTRDTTPIISGVITAALASGQYVEVVINGKTYTSEPGGAVVVDPAHNTWYVQLPD
FT                   TDALTVSATAYTVTAQVKSSAGNGNNANISNGTVTVNAAIDYTPTWTTASKTTAWGLTY
FT                   GLDSHGMWTVLANQQVMQSTDPLTWSKTALTLYQSGNNYATSSIADYDRNGTGDLFITR
FT                   DDYGTGYINGFTNNGDGTFSSAIQVTVGTLTWYGSIVAFDKEGDGYLDFWIGDAGGPDS
FT                   NTFLWNNAGTLVGNSTTSNSGGSATVGGAVTGYLSLNEGSGVDLNNDGRIDLVQHTYNL
FT                   NNYYTLSSLINQGNGTFVWGQNTTNTFLSGAGSGAMSSSVSMTWADFDGDGDMDLFLPA
FT                   SQGRANYGSLLFNTNGVLGCPVAVGATATTYASQFSLAVDWNHDGLMDIARIAQTGQSY
FT                   LYTNVSNASNWTQSALGGSQSGTTSGVAAMDYDWDGAVDVLVSKQSGSVFLSRNTNTVS
FT                   YGTSLHLRITDPNGINVYYGNTVKLYNSAGVLVATQIINPQSGMGVNDTSALVNFYGLN
FT                   AGETYNAVLIKSTGTTASNIDQTVNTSWGGLQATDATHAYDLSAEAGTASNNGKFVGTG
FT                   YNDTFFATAGTDTYDGSGGWVYSSGTGTWLANGGMDVVDFRLSTVGVTANLSSTAAQAT
FT                   GFNTSTFTNIEGISGSNFNDILTGSSGDNQLEGRGGNDTLNIGNGGHDTLLYKLLNASD
FT                   ATGGNGSDVVNGFTVGTWEGTADTDRIDIRELLQGSGYTGNGKASYVNGVATLDAQAGN
FT                   IGDFVKVTQSGSDTIVQIDRDGTGGTFATTNVVTLTGVHTDLATLLANHQLMVV"
     gtgccagctt ccgcagtagg tgcgctgggc gaagccagct acacggtgac ggcgaacgtc        60
     accgacagcg caggcaacag caattccgcc agccataacg tgcaggtcaa taccgcgctg       120
     cctggcgtca ccattaaccc agttgcgacc gacgatatta ttaacgccgc cgaatcgggc       180
     aatgcgcaaa ccatcagcgg ccaggtgacg ggggcggcgg cgggcgatac ggttaccgta       240
     acgcttggcg ggaaaactta caccgctacc gtgcagggga atttaagctg gagcgtggac       300
     gttccggcgg cggatattca ggccatcggc aatggcaatc tgacggttaa cgcttcggtg       360
     accaacggcg ttggcaatac tggcagcggt tcgcgagata ttactatcga cgccaacctg       420
     ccaggtctgc gcgttgacac cgtggcgggc gatgatgtgg tcaatagcat cgagcacgct       480
     caggcgctgg tgataactgg tagcagcagc gggctggcgg cgggcgcggc gctgacggtg       540
     gtgattaaca cggtcactta cgctgcaaca gtattagccg atggcacatg gagcgttggt       600
     gttccggcgg cagacgtgag taactggcct gcgggtacgg tgaatatcac ggtaagtggc       660
     actaacacag ccggaacaac atccaccatc acccatccgg tcaccgtcga tctggcggcg       720
     gtggcgattt ccattaacac cgtttccggc gacgatgtga ttaacgccgc cgaaaaaggg       780
     gcagatttaa ccctttccgg cagcacctcc ggcgtggaag tggggcaaac ggtcaccgtt       840
     acctttggcg ggaaaaccta caccgctacc gtagcgggcg atggtagctg gacaaccacc       900
     gtacccgccg ccgatctcag cgtgttacgc gacggcgacg ccaccgtgca ggccagcgtc       960
     agcactatta acggcaacac ggcttcggca acccacgcct acagcgtcga tgccacggcc      1020
     ccgacgcttg ccattaacac catcgccacc gacgatattc tgaacgctgc cgaggcgggc      1080
     aatccgttaa ccatcagcgg tagcagcacc gccgaagcgg ggcagacggt aaccgtcacg      1140
     cttaatggtg tgacttacag cggctccgtc caggcggacg gcagctggag cgtcagctta      1200
     ccgacggcgg atctcagcaa tctgaccgcc agccagtaca ccgttagtgc ctcggtaagc      1260
     gataaagcgg gtaacccggc gtccgctaac cacgggctgg cggtggatct caccgtgccg      1320
     gtgctgacca tcaacaccgt ctccggcgat gacattatta acgccgccga acacggacag      1380
     gcgctggtga tctccggctc cagcactggc ggcgaagcgg gtgatgtcat caccgtcaca      1440
     ctaaacagta aaacctacac caccatgctg gacgcttccg gcaactggag cgtcggcgtt      1500
     ccggcggctg acgtcactgc gcttggcagc ggcccgcaaa ctatcactgc ggcaattacc      1560
     gacgcggcag gcaacagcga tgacgccagc cgcacggtca ccgtgaatct cgccgcgcca      1620
     accattggta tcaacaccat cgccaccgat gacgtgatta aagccacgga aaaaggcgcg      1680
     gacctgcaaa tcaccggcac cagtaatcag cctgcgggca ccaccattac ggtgacgctg      1740
     aacgggcaaa attacaccgc tactaccgat agcaacggca actggagcgc cacggtgcca      1800
     gcgtcagcgg ttagcgcatt gggtgaagcc aactacacgg taacggcaaa cgtcactgat      1860
     acggcaggca acagtaattc cgccagtcat aatgtgctgg tcaacagcgc cttgcctgcc      1920
     gttaccatta acgcggtggc gactgacgat attattaacg ctgccgaatc gggaaatgcg      1980
     caaaccatca gcgggcaggt gacgggcgca gcgcaggggg atacggttac cgttacgctg      2040
     ggcggcaaca cctacaccgc cacggtgcag tctaatttaa gctggagtgt ggacgttccg      2100
     gcggcggata ttcaggcgct gggcaacggc gacctgacgg ttaatgcctc ggtcaccaat      2160
     ggcgtcggca acaccggcag cggctcgcgc gatatcacga tcgacgccaa tctgcctggc      2220
     ctgcgggtcg ataccgtggc gggcgatgat gttattaaca gcattgagca caatcaggcg      2280
     ctggtgatca ccggcagcag cagcggatta acggcgggaa cggcgttaac ggtcgagatt      2340
     aacaacgtta cttatggcgc gacggtatta gccgacggca cgtggagcct cggtgttccg      2400
     gcggtagacg tcagcaactg gccagcgggt acggtgaata tcacggtaag cggcaccaac      2460
     agtgccggaa caacctccac cattacccat ccggttaccg tcgatctggc tggggtcgcc      2520
     atcaccatta acactctctc tggtgatgat gtgatcaacg ccgtcgaaaa aggcgaaacg      2580
     ctggtcgtaa gcggcagcac cagcggtgtc gaagccgggc agacggtgac cgtcaccttt      2640
     ggcggcaaaa attacaccac cacagtggaa gctaacggta gctggacggt gaatgtgccg      2700
     cctgccgatc tcgctgcgct accggacggc gcgggcaacg tgcaggcgag tgtcagtaat      2760
     attaacggca acagcgccca ggccgatcgc gcgtatagcg ttgatgccac cgcgccgctt      2820
     gtgaccatca acaccatcgc cagcgacgat atccttaacg tgagcgaagc tggcgcgggg      2880
     atcaccatca gcggcactac cacggcgcag gccgggcaga cgctcaccgt cacgctcaat      2940
     aacaacacgt accagaccac cgttctggcg gatggcacct ggagcgtgaa tgttccggca      3000
     gcggatttaa gcggattaac cgccagcagt tacaccgtga ccgccacggt gagcgacaaa      3060
     gcgggtaacc cggcaagcgc cgaccacgcg ctggtggtag atatcactgc gccggatctc      3120
     accattaaca ccgtcgcggg cgatgacatt atcaacgcca tcgaacatgg tcaggcgttg      3180
     gtggtcagcg gcaccagtac gggcgcggcg gcgggtgatg tggtaaccgt cacgctgaac      3240
     ggtaaaaact acaccaccac gctggatgcc tccggtaact ggagcgtggg cattccggcg      3300
     gcggatgtca cggcgctggc gaccggtagc cagaccatca ccgccagcct gagcgatcgc      3360
     gcgggcaaca gcgacagcac gactcacgat gtgaccgttg atcttagcgg cccgacgctg      3420
     accattaaca ccgtctccgg cgatgacatt atcaacgccg ctgaaatcgt tgtggcgcag      3480
     accatcagcg gtcaggtcac gggaacggcg gttgccggga atacggtgat tgtcaccatt      3540
     ggcggcaatc aatataacgc caccgtgcag tcagatttaa gctggagcgt cagcgtaccg      3600
     gcgaacgttt tgcaggcgct gggtaacggt gaactgacca tcagcgcctc gttgaccaat      3660
     tccgcaaata ataccggcac cgcgacgcac gatatcgtga tagatgccaa cctgccaggt      3720
     ctgcgcgtcg ataccgtggc aggcgatgat gtgattaaca gcatcgagca cactcaggcg      3780
     ttggtgatca ccggtagcag tagcggactg gcggcgggcg cggcgttgac ggtggttatc      3840
     aatagcgtca cctacggcgc aacggtttta gcggatggta gctggagcgt tggtgttccg      3900
     gtggcagatg tcacaaactg gcctgcgggg acggtcaata ttgccgtctc tggcaccaac      3960
     accgccggaa ccacaaccag cattagccat ccggtcacgg tcgatctcgc tgccgtggcg      4020
     atcaccatca acaccctttc cactgacgat gtgattaacg ccgccgagaa aggctctgat      4080
     ttgcagctct ccggcaccac ctccggcgtg gaagcggggc aaaccatcac cgttatcttc      4140
     ggcggcaaaa gctacaccac cacggttgcc gcggataata cctgggggct gacgatccct      4200
     gccgtcgatg ttgcaacctt gccagacggc gcagcaaacg tccaggccag cgtcagcaat      4260
     gtcgcaggga acagcaccca ggcaacgcat gcttacagcg ttgatgccac tgcgccctcc      4320
     gttaccatca acaccatcgc cacggacgat attcttaacg ccgccgaagc gggatcggcg      4380
     ctgaccatca gcggcaccag cacggcggaa gccgggcaga cggtgaccgt aacgctaaac      4440
     ggcgttaatt acagcggcaa tgtgcaggca gacgggagct ggagcgtcag cgtaccaacc      4500
     ggcgatttag ctagccttac cgccagctcg tataccgtta acgcctcggt cagcgacaaa      4560
     gccagaaatt cggcttcggc aacgcataat ctgacggtgg accttgccgc tccggtcgtc      4620
     accatcaaca cggtggcggg cgatgacatc attaacgcca cggaacacgg acaggcgcag      4680
     atcatcagcg gctcggcaac gggcgcgact accggtaata cggtttccgt gacgattggc      4740
     acgaccacct ataccaccgt gctggacgcc aacggcaact ggagcatcgg cgtgcctgcc      4800
     agcgtgattt ccgcgctggc gcagggcgat gtgaccatta ccgctacggt caccgactcc      4860
     gcaggcaaca gcggcacggc ctcgcacact gtcaccgtgg cgctcggcgc tccggtgctc      4920
     gccattaaca ccattgccgt cgatgacatc atcaacgccg cggagaaagg cgcggatctg      4980
     gcgattaccg gcaccagcaa ccagcctgcg ggcacgcaga ttaccgttac gctcaacggg      5040
     caaaattaca ccaccactgc cgatgcttcc ggtaactgga gcgtgaccgt tccggcgtca      5100
     cgggtgagcg ccctcggtga agccacctac acggtgaccg cagccgccac tgacgccgat      5160
     ggcaacagcg gttccgccag ccataacgta caggttaata ccgcgctgcc gggcgtcacc      5220
     attaacgtgg tggcaacgga cgatattatt aacgccgccg aagcgggcgt ggaacagacc      5280
     atcagcgggc aggtgacggg tgcggcggca ggcgacacgg tgaccgtcac gctcggcggg      5340
     gcgacttaca ctgccacggt gcaggcgaat ttaagctgga gcgtcgatgt tccggcctcc      5400
     gcgctacagg agttgggcaa cggcgaactg accatttcgg cttcggtgac gaacagcgta      5460
     ggcaatactg gtaacggcac gcgcgaaatc accatagacg cgaatctccc cggtctgcgg      5520
     gtcgacaccg tggcgggcga tgatgtggtt aatattatcg agcacgggca ggcgctggtg      5580
     attaccggca gcagctccgg tctggcggcg ggcagcaacg tcacgctgac cattaacggg      5640
     caaacctatg ttgcggcggt gctggcggat ggcacctgga gcgtcggcgt tccggcggtg      5700
     gatgtcagcg cctggcctgc gggatcggtg acgattgcgg cgagcggtag cacctctgcc      5760
     ggaaatccgg taagcgttac gcatccggtg acggtcgatc tctcggcggt ggcggtgagc      5820
     atcaacgcca ttaccgccga tgatgtgatc aacgctgccg aaaaaggcgc ggcgttaacg      5880
     ctctccggca gcacctctgg cgttgaagcc ggacaaacgg ttaccgtcac ctttggcggc      5940
     aaaacttaca gcgccacggt ggctgcgaat ggttcctgga gcacctcggt tccggcggca      6000
     gatatggcgg ctctgcgtga tggcgatgcc agcgcacagg ccagcgtcag caatgttaac      6060
     ggcaacagcg ccaccacgac ccacgcttac agcgttgatg ccagcgcgcc aacggtgacc      6120
     attaatacca ttgcgggcga tgatattctt aacgccgccg aagccggagc ggctctgacc      6180
     atcaccggca gcagcacggc ggaagcgggg cagacggtga ccgtcacgct caatggcaca      6240
     aactacaccg gcaccgtaca gacggacggc agctggagcg tcagcgtacc gtcagccgac      6300
     ttaagcaccc tgaccgccag caactacacc gtgaacgcgg cggtgagcga caaagccgga      6360
     aacccggcct cggttaatca caacctgacg gtggatacgt ccgttccggt cgtcaccatc      6420
     aacacggtgg caggcgatga tgtgatcaac gcgacggaac acgcccaggc gcagatcatc      6480
     agcggctccg ccactggagc ggcaaccggt agcaccgtga cggtgactat cggcacaaat      6540
     acctttacca cggtgctgga tgccagcggc aactggagcg tcggcgttcc ggcaagcgtc      6600
     gtctcggcac tggcgaatgg cacggtgacc atcaatgcca gcgtcaccga tgccggagga      6660
     aacagcggca gcgctaccca tcaggtgacg gtcaataccg ggctgccgac cattaccttt      6720
     aacgccatca gcggcgataa catcctgaac gccgatgaaa aaggccagcc gttgaccatc      6780
     agcggcggca gtacggggct ggcgacgggc gcgcaggtca ccgtcacgct caacggtcac      6840
     aactacagcg ccaccaccga cgcatcgggc aactggacct taaccgtgcc ggtgagcgat      6900
     ctggcggcat taggtcaggc caactatacg gtcagcgcca gcgccaccag tgcagcaggc      6960
     aacaccgcca gcagccaggc gaatttactg gtcgacagcg gcctgccgga cgtcaccatc      7020
     aacaccgtgg caggcgacga tattatcaac gccgccgaag cgggggccga tcaaaccatc      7080
     agcggggtgg tgactcgcgc cgccgctggc gatacggtca ccgtgacgct gggcgggaac      7140
     acttacaccg ctacggtaca gagcaactta agctggagcg tcagcgttcc gacagccgat      7200
     ctccaggcgt tgggcaatgg tgatttgacc attaccgcct cggtcaccaa cgctaatggc      7260
     aacaccggga gcggcacgcg ggatatcacc attgatgcca acctgccggg gctgcgcgta      7320
     gataccgtgg cgggcgatga tatcgtcaac agcatcgagc acgggcaggc gctggtgatc      7380
     accggcggca gtagcggcct gaatgcaggt gctgtgctga cggttaccat caacagtgtg      7440
     gcgtattccg ccacggtgca ggcggacgga agctggagcg ttggcattcc ggcggcaaac      7500
     gtcagcgcct ggcctgcggg gccgttaacc gtggaggtag acgggcaaag cagcgccaat      7560
     aacccagtca gcgtcagcca tccgttcacc gtcgatttaa cggcggtggc aatcagcatc      7620
     aacaccgttg ccagcgacga cgtgattaac gccgcagaaa aaggcaccaa tctgactctt      7680
     tccggcagta ccagcgggat tgagagcggg caaaccgtca ccgtcacttt tggcggtaaa      7740
     acctacactg caagcgtcgc cgccaacggg agctggagtg taaacgttcc ggcggcagat      7800
     ctggcaactc tgccagaggg cgcggcgaat gtgcaggcca gcgttagcag cgcgagcggt      7860
     aacagtgcct cggcgaccca tgcgtatagc gttgacgcca gcgcgccgac gctcaccatt      7920
     aacaccatcg ccagcgacga tatccttaac gccgcagaag ccggaagccc gctcaccatc      7980
     agcggcacca gcaccgccga aaccgggcag acggtgaccg tcacccttaa cggcgcaacc      8040
     tacaccggca ctgtgcaggc ggacggtagc tggagcgtca gcgttcccac ttcagccctg      8100
     ggcgcgctca acgcaagcaa ttacaccgtc agcgccacgg tcaatgacaa agcgggcaac      8160
     cccggcagcg ccagccataa tctggcggta gacaccaccg cgccggttct caccattaac      8220
     accgtggcgg gcgatgacat catcaacgat gccgaacatg cgcaggcgct ggtgatctcc      8280
     ggcaccagta gcggcgggga agcgggcgat gtggtgagcg ttgtgctcaa cggcaaaacc      8340
     tacaccacca ccctggatgc ctccggcaac tggagcgttg gcgttccggc ggcagatgtt      8400
     acggcgctgg gtagcggtgc gcagaccatc accgccagcg tcagcgatcg ggcaggcaac      8460
     agcgacgacg ccagccgcac cgtgaccgtc agcctcagcg cgccagtgat tagcatcaac      8520
     accatcgcgg gcgatgatgt gatcaacgcg acggaaaaag gatctgatct ggcgctttct      8580
     ggcaccagcg atcagcctgc gggtacggcg atcaccgtca ccctgaacgg acaaaactac      8640
     agcgccacca cggatgcctc cggcaactgg agtgttaccg tgcctgcctc ggcggtcagt      8700
     gcgctgggcg aagcgaccta cagcgtgacg gcgagcgtca ccaatgctca gggtaacagc      8760
     agcaccgcca gccataacgt gcaggttaat accgcgctgc cgggcatcac cattaatccg      8820
     gtggcgacgg acgatattat caacgcttca gaggcaggca gcgcgcaaac tatcagcggc      8880
     caggtaaccg gtgcggcggc gggcagcacc gtcaccgttg aactgggcgg taaaacttac      8940
     accgccaccg tccaggctga tttaagctgg aatgtgagcg tacctgccgc cgactggcag      9000
     gctctgggta acggtgagtt aacggttaat gcctcggtga ccaacgccgt tggcaacacc      9060
     ggtagcggca cgcgcgatat caccatcgat gccagtctgc ctggcctgcg ggtggatacc      9120
     gtcgcgggtg atgatgtggt caatatcatc gaacacgctc aggcgcaggt gatcaccggc      9180
     agcagctccg gctttgccgc aggcacggcg ttgacggtgg tgattaacaa ccaaacttac      9240
     gccgccacgg tgttggcgaa cggtagctgg agcgtcggcg ttcctgcgac ggatgtcagt      9300
     aactggcctg cgggaacgct gaatattacc gttagcgggg cgaacagtgc cggaacgcaa      9360
     accagcatta cccatccgct gactgttgat ctcaccgccg tcgccatcag catgaacagc      9420
     atcaccagcg atgatgcgat taacgccgcc gaaaaaggcg cggcgttaac gctctccggc      9480
     agcacgtccg gcgtcgaagc ggggcaaacc gtcaccgtca cctttggcgg caaaacctac      9540
     accaccacgg tggcggcaaa cggtagctgg agcaccaccg ttccggcggc ggatttggcg      9600
     gccctgcgtg atggcgatgc cagcgcccag gtgcgggtga ctaacgtcaa cggcaacagc      9660
     gccacagcaa cgcacgaata cagcgtcgat agcgccgcgc caacggtgac catcaacacc      9720
     attgccagcg ataacatcat caacgccagc gaagcggcgg cgggcgtaac ggtgtccggc      9780
     accagcaccg cgcaaaccgg gcagacgctc accgtcacgc ttaacggcac taactaccag      9840
     accacggtgc agacagacgg cagctggagt ttaacgctgc ccgccagcga cttaaccgca      9900
     cttgctaata acggctacac cctgaccgcc acggtcagcg atctggcggg taaccttggc      9960
     agcgccagca aaggcgtgac cgtcgatacc actgcgccgg tgatcagttt taacaccgtg     10020
     gcgggcgatg atgtgattaa caacgtcgaa cacattcagg cgcagattat cagcggcacc     10080
     gccacgggcg cggtggcggg cgaccgcctg gtggtgacca tcgccgggca gcagtatgtc     10140
     accagcaccg atgccagcgg caactggagc gtcggcgtgc ctgccagcgt gatttccggc     10200
     cttgcggatg gcacggtgac catcagcgcc accattaccg atagcgcagg caacagcagc     10260
     acgcagacgc acaacgtaca ggtgaacacg gcggcagtgt cgctctcggt cagcactatc     10320
     agcggcgata accttattaa cgccgccgaa gcgggcagtg cgctgaccct gagcggcact     10380
     ggcactaatt tcgcgacagg tacagtggtg accgtgttgc ttaacggcaa aggctacagc     10440
     gccaccattc agagcaacgg gagctggagc gtgaacgtgc ctgcggcgga tgttgcggca     10500
     ctcagtgatg gcaccagcta cacggttagc gcctccgctc aggacagtgc cggaaacggc     10560
     aacagcagca cgcagacgca caacgtacag gtgaacacgg cggcagtgtc gctctcggtc     10620
     agcactatca gcggcgataa ccttattaac gccgccgaag cgggcagtgc gctgaccctg     10680
     agcggcactg gcactaattt cgcgacaggt acagtggtga ccgtgttgct taacggcaaa     10740
     ggctacagcg ccaccattca gagcaacggg agctggagcg tgaacgtgcc tgcggcggat     10800
     gttgcggcac tcagtgatgg caccagctac acggttagcg cctccgctca ggacagtgcc     10860
     ggaaacagcg ccacggcctc gcgcagcgtg gcggtggatc tcaccgcgcc ggttatcagc     10920
     attaacaccg tttcgacgga cgaccgcctc aacgccgccg aacagcagca gccgttaacc     10980
     cttaacggct cgaccagcgc ggaagtgggg cagacggtca ccgtcacctt tggcggcaaa     11040
     acctataccg ccacggttgc cgccaatggt acctgggcgc tgaacgtgcc tgcggtggat     11100
     ctggccgcgc tcgggcaggg cgcgcagacc attaccgcca gcgtgaacga tcgcgccggt     11160
     aaccccggac aggccacgca cgccctgacc gtcgataccg ttgcgccaac ggtcaccatc     11220
     gccacggtgg cgggtgacga tattatcaac aacgccgagc agcttgccgg gcagaccatt     11280
     agcggcacca ccaccgccga agtgggccag acggtgaccg ttacctttaa cgggcaaacc     11340
     tggagcgcaa cggttggcag cggcggaagc tggtcggtgt ttattccggc gcagcagttt     11400
     gccggattaa gcgacggcag ctacaccatt agcgcgacgg ttagcgatca ggccggaaac     11460
     cccggcagcg ccagccgtgg cgtgacgctg aacggcgatg tacctactgt caccatcaac     11520
     acctttgcgg gcgacgatgt ggtgaatgca gcggaacacg gctcatcgct ggtgatcagc     11580
     ggcaccacca ccgcgcccgt cgggcagacg ctgaccctga ccttaaacgg caaaacctac     11640
     accaccacgg tgcagacggg cggtagctgg agctacaccc tcggcagcgc cgatgtcacc     11700
     gcgctggcgg acggcaacgc ctacgtgatt aacgcctcgg tgagcaatgc cattggcaac     11760
     accggtagca gtaatcacac cattaccgtc gatctcagcg ctccggcgat gggcattaat     11820
     atcgattccc tgcaagccga cactggcctt agcgccagcg actttatcac cagcgtcagt     11880
     ccggtagtgg tcaacggctc gctcaccgcc gcgcttgcca gtaacgagac ggcgcaaata     11940
     agtatcgacg gcggcacaac ctggaccacg cttaccgtta ccggcacgac ctggcgctat     12000
     aacgacagcc gcacgctgac cgatggcaac tatctctatc aggtgcgggt gattgacgca     12060
     gcgggcaacg ttggcgcgac cgacagccag aatgtggtga tcgacactac cgcgccagat     12120
     cccgcggtga aaaccatcgc catcagcgcg atcaccaccg atatgggctt gatcactaac     12180
     gattttgtca ccagcgacac gacgcttgcg gtgagcggca cgctgggggc gacgctttct     12240
     gccggtgagt tcgcgcaaat cagcctcgac ggcggcgtca cctggactac gttaaccgtc     12300
     gttggcacca gctggagcta tgccgatggt cacacgctta ctgacggcac ctggaactac     12360
     acggtgcggg tggtggatct ggcggggaac gttgggcaga ccgcaacgca aaacgtggtg     12420
     gtcgacacca ccagcccgga agcggcgaaa agtatcacca ttaccggtat cagcgatgac     12480
     accggaacca gcagcagcga ttttattacc agcgacacca cgcttaccgt gcgcggcgta     12540
     ttgggcgcgg cgctcggcgc taatgagttc gcgcaaatca gtaccgacaa cggcgcaacc     12600
     tgggtgaacg tgaccgtcgc cgcagacagc ctgaactgga gttacgttga cggacgaacc     12660
     ctcaccaacg gcaccaccac ctggcaggtg cgggtggtcg atctggcggg caacgttggc     12720
     gcaacgagca gccagtcggc gctgatcgat accgttaacc cggcgcaggt gctcaccatc     12780
     gccagcatca gcaccgacac ggggagttcg gcaactgact ttatcaccag cgacaccatg     12840
     ctcacgctga ccggttcgct gggggcgggg cttgccagcg gcgaagtggc gcagattagc     12900
     cttgatagcg gcgcgacctg gacaacgctc accaccaacg gtacacagtg gacttacacc     12960
     gacagccgca cgctgaccga cggcagctac gtttatcagg tgcgggtgct ggatctggcg     13020
     gggaacaccg gcccggtggt gtcgaaaacg gtggtggtcg atacgattaa ccccaccgcc     13080
     acaccaacga ttgtgtcgta taccgatgat gtcgggcagc ggcaggggac attaagcagt     13140
     tcgcaggcca ccgacgacac tacgccgctg ctgaacggtg tactttccgc gccgcttgcc     13200
     agcggtgaag tggtttacct ctaccgtaac gggctgctgt taggggcggt gacgatggtc     13260
     ggcgctctga actggaccta cagcgacagc gggctggtga gcggtgccta tacctacagc     13320
     gcgcgagtgg tggatttggc ggggaatatc acctcctcca gtgattttgt cctgacggtc     13380
     gatacctcta ttccgaccac gctggcgcaa atcaccagcc agaccacgcg cgatactacg     13440
     ccgattatta gcggggtgat caccgccgcg cttgccagtg ggcagtatgt tgaagtggtg     13500
     atcaacggca aaacctacac ctctgaaccg ggcggcgcgg tagtggtcga tccggcgcac     13560
     aacacctggt atgtacagtt gccggatacc gatgcgctga cagtttccgc gaccgcctat     13620
     accgttactg cgcaggtaaa aagttcggcg ggtaacggca ataacgccaa tattagcaac     13680
     ggcacggtga cggttaacgc ggcgattgat tacacaccga cctggactac cgccagcaaa     13740
     accaccgcct gggggctgac ctacggcctc gactcgcacg ggatgtggac ggtgctggca     13800
     aaccagcagg taatgcaatc gactgaccca ctcacctggt cgaagaccgc gctgacgctg     13860
     tatcagagcg gcaacaacta cgccaccagc tccattgccg attacgaccg taacggcacg     13920
     ggcgatctgt ttatcacccg tgatgactac ggtacgggct atattaacgg ctttaccaat     13980
     aacggcgatg gcaccttttc cagcgctatt caggtcaccg tcggcaccct gacgtggtac     14040
     ggctcgattg tggcatttga taaagagggc gacggctatc tcgacttctg gattggtgac     14100
     gctggcgggc cggactccaa caccttcctg tggaacaacg caggcacgct ggtaggcaac     14160
     tccaccacgt cgaacagcgg cggtagcgcc acggtgggcg gggcggtgac ggggtatctt     14220
     tcgctcaacg aaggttctgg cgtcgatctg aacaatgacg gcaggatcga cctggttcag     14280
     cacacctata acctgaacaa ctattacacg ctgtcttcgc tcatcaacca ggggaatggg     14340
     acgtttgtct gggggcagaa caccaccaat accttcctga gcggggcggg cagtggcgct     14400
     atgagcagca gcgtttccat gacctgggcc gatttcgatg gtgacggcga tatggatctc     14460
     ttcctgcccg ccagccaggg aagagctaac tacggctcgc tgttattcaa caccaacggc     14520
     gtactgggtt gcccggtggc ggtgggcgca acggcaacca cctacgccag ccagtttagc     14580
     ctggcggtgg actggaacca cgacggcctg atggatatcg cccgtatcgc ccagaccggg     14640
     cagtcgtatc tttatactaa cgtcagcaac gccagcaact ggacgcaatc ggccctcggc     14700
     ggcagccaga gcggtaccac cagcggcgtg gcggcaatgg actacgactg ggacggcgcg     14760
     gtggatgtgc tggtgtccaa acagtcgggc agcgtgttcc tgagccgcaa caccaacacg     14820
     gtgagctacg gcacttcgct acacctgcgc atcaccgatc ccaacggcat taacgtctat     14880
     tacggcaata ccgtgaagct gtacaactcg gcgggagtgc tggtcgccac gcaaatcatc     14940
     aacccgcagt cgggtatggg ggttaacgac acctcggcgc tggtcaactt ctacgggctg     15000
     aatgccggag aaacctacaa cgcggtgctg atcaaatcca ccggcaccac cgccagcaat     15060
     atcgaccaga cggtcaacac cagctggggc ggtttacagg ccaccgatgc cactcacgct     15120
     tacgatctca gcgctgaagc gggtaccgcg agcaacaacg gcaagttcgt cggcaccggc     15180
     tataacgaca ccttcttcgc caccgcaggc accgacactt acgacggttc cggcggctgg     15240
     gtgtacagct ccggcaccgg aacgtggctg gcgaacggcg ggatggacgt ggttgatttc     15300
     cggctttcga cggtgggcgt gacggctaac ttaagcagca ctgccgcgca ggccaccggt     15360
     tttaacacct cgacatttac caatatcgaa ggcatttccg gctcgaattt taacgacatt     15420
     ctgaccggca gcagcggcga taaccaactg gaagggcgcg gcggcaacga cacgctcaac     15480
     atcggcaacg gcggccacga caccttgctc tataaactgc tcaacgccag cgacgccact     15540
     ggcggcaacg gctcagacgt ggtgaatggc tttacggtag ggacatggga aggcaccgcc     15600
     gacaccgatc gcattgatat tcgtgaactg ttacagggca gcggctacac cggcaacggc     15660
     aaagccagct acgtcaacgg cgtggcaacg ctggatgcgc aggccggaaa catcggtgac     15720
     tttgtcaaag tcacccagag cggcagcgac accatcgtgc agatcgaccg cgacggcacg     15780
     ggcggcactt ttgcgacaac taacgtggtc acgctgacgg gcgtgcacac cgacctcgcc     15840
     accttgctgg cgaatcatca gttgatggtg gtgtag                               15876
//

If you have problems or comments...

PBIL Back to PBIL home page