(data stored in ACNUC7421 zone)

EMBL: BA000007.PE521

BA000007.PE521       Location/Qualifiers
FT   CDS_pept        603985..605160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0544"
FT                   /product="membrane fusion protein of a transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33967"
FT                   /db_xref="GOA:Q8XD11"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD11"
FT                   /protein_id="BAB33967.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
     atgaacggac aactgcaata taaccgtggt ctgactgaac cccgcctgcc gcgttcggcg        60
     ctggcggtac gcgttaccgc tgtgatgctg ctctgttttc tcggctgggc gtggtacttc       120
     cagcttgatg aagtcaccac cggcagcggc acggtagaac cttccgggcg cgaacaggtg       180
     gtgcagtcgc tggaaggcgg aattctgtat catctcgacg tgaaagttgg cgatattgtc       240
     gaacagggcc agccgctggc gcagcttaac cgcaccaaaa cggaatccga cgtccaggaa       300
     gcgatgtcgc ggctgtacgc ggcgctggca acctcggcgc ggctgcgggc ggaagtgagc       360
     aataaaccgc tggtcttccc tgacgaactg aataaattcc ccgaacttat cgagtcggaa       420
     acggcgttgt acaacactcg ccgcgacggg ttgaacaaag ccaccaccgg gctgacgcag       480
     gggattagcc tggtcaatcg cgaactggcg atgacccagc cgctggtaaa acagggggca       540
     gcgagcagcg tcgaagtact gcgcctgcaa cgccaggcca atgaactgga aaacaaactc       600
     agcgacgtgc gcacgcaata ctacgttcag gcgcgcgaag agttagcaaa agccaatgcg       660
     gaagtggaaa cccagcgttc ggtgatccgt ggacgggaag actctctcac caggctcaac       720
     tttaccgcgc cggtgcgagg cattgttcag gatattgatg tcaccacggt tggcggcgtc       780
     atcgcccccg gtggtaaact gatgaccatc gtgccgctgg atgagcaact gctgattgag       840
     gcaaaaatct ccccgcgcga tgtggcgttt atccacccgg ggcaaaaatc gctggtgaaa       900
     ataactgcct acgattactc catctacggc ggcctgccgg gagaagtggc ggtgatatca       960
     ccagacaccg tgcaggatga agtgcggcgc gatgtttatt actatcgggt gtacattcgc      1020
     actttcagca accatctgga aaacaaaagc aaacagcagt ttccgatatt ccccggtatg      1080
     gtggcgacgg tcgatatccg caccggcaaa aaaagcgtgc tggattatct gttgaaaccc      1140
     tttaacaaag cacaggaggc gttgcgcgaa cgatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page