(data stored in ACNUC7421 zone)

EMBL: BA000007.PE525

BA000007.PE525       Location/Qualifiers
FT   CDS_pept        607658..608020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33972"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC29"
FT                   /protein_id="BAB33972.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMSKGREE"
     atgaatgaat ttgagaagat ttttaatgaa atgaatctgg accgggcatt gctaccgatc        60
     ctttttcgtt cgaaccggtc gacagtgtgg aagtatttaa gcggcgatag tacggctcct       120
     gcctctgcca tgtcgctgat tatgctgttg cagttgatac agaaacgaaa ccccgatctg       180
     ttagccgaat ggttaacgct ttctgatttc accattccgc cagaagttta cctggaccag       240
     cctgattact ggaaagggtg ggtgtatacg caacacaagg tcaataaaaa cgtcctggaa       300
     tatctaaaaa aacactatcc ggatgaagac caaaaaagta tgagtaaagg ccgggaagag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page