(data stored in ACNUC7421 zone)

EMBL: BA000007.PE572

BA000007.PE572       Location/Qualifiers
FT   CDS_pept        complement(659140..662112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0600"
FT                   /product="bacteriophage N4 receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34023"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR8"
FT                   /protein_id="BAB34023.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFT
FT                   TDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYAVSVATRNKAEALRLARLLYQQESANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARISQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPNAWQHRA
FT                   VAYQAYQVEDYATALAARQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GSNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRFFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
     atgaaggaga ataaccttaa tcgcgtcatc ggatggtctg gtttactgct gacgtcttta        60
     ttgagtacca gcgcactcgc agacaatatc ggcaccagcg cagaagagct ggggctgagc       120
     gattatcgcc attttgttat ttatccccgt ctcgataagg cgctgaaggc acagaaaaat       180
     aacgacgaag caaccgccat ccgcgaattt gaatatatac accagcaggt gccggataat       240
     attccgctga ctttatacct tgcggaagcc tatcgccatt ttggtcatga tgaccgggca       300
     cggctgttgc ttgaggatca actgaaacgt cacccaggag atgcccgact tgagcgcagt       360
     ctggcggcta ttccggttga agtgaaaagc attacaactg ttgaagaact gcttgcccag       420
     caaaaagcgt gcgatgctgc gccgaccctg cgttgtcgca gtgaagtcgg gcagaatgcc       480
     ctgcggctgg cacagttacc tgtcgccaga gcgcaactga acgacgcgac gtttgctgca       540
     tcgccggaag gaaaaacgct gcgaaccgat ctgctgcaac gggcaatcta cctgaaacaa       600
     tggtcccagg cagatacgct atacaatgaa gcacgccagc agaacacatt aagcgcggca       660
     gaacgccgtc agtggtttga cgtgcttctt gccgggcagc tggacgatcg gatcctggca       720
     ctgcaatcac aggggatctt caccgatcct cagtcatata ttacttacgc gaccgcgctg       780
     gcttatcgtg gcgaaaaagc acgcctccag cattatctca ttgaaaataa gccgctgttt       840
     accacggacg cacaagagaa aagttggctc tatctgttat ctaaatacag cgccaacccc       900
     gttcaggcat tggcgaatta tacggtgcag tttgccgata accgccagta tgttgttggc       960
     gcgacgctac cggtgctgtt aaaagaaggt cagtacgacg cagcgcaaaa actgctcgcc      1020
     accctccccg ccaatgaaat gcttgaggag cgttatgctg tcagcgtggc gacccgtaac      1080
     aaggctgaag ctctgcgtct ggcacgcttg ctgtatcagc aagaatcggc aaatcttacc      1140
     cgcctggatc aactaacctg gcaactgatg cagaacgagc agtcacggga agctgccgat      1200
     ttattgctgc aacgctatcc tttccagggc gatgcgcgta tcagccagac tttaatggcg      1260
     cgactggcgt ctctgctgga aagtcatcct tacctggcaa cgccggcgaa ggtggcgatt      1320
     ttatcgaaac ccttaccgct ggcggagcaa cgtcagtggc aaagtcagtt gccgggtatt      1380
     gcagataatt gcccggcaat agttcgcttg ctgggcgata tgtcgccttc ctacgatgcc      1440
     gccgcctgga accgtctggc aaagtgttat cgggacacgc tacccggtgt ggcgttgtat      1500
     gcatggcttc aggccgaaca acgacaaccg aacgcctggc aacatcgtgc ggtagcctat      1560
     caggcgtatc aggttgagga ctacgccacc gcactggcgg ccaggcagaa aatcagtctt      1620
     cacgacatga gcaatgagga tctgcttgct gctgccaata ccgcccaggc ggcaggaaat      1680
     ggtgcggctc gcgatcgctg gctacaacag gcagaacaac gtggactggg aagcaatgcc      1740
     ctctactggt ggctgcatgc gcaacgttac attcctggtc agccggaact cgcactgaac      1800
     gatctcacgc gctcaatcaa tattgcgcct tctgccaacg cttacgttgc gcgggcgaca      1860
     atttatcgcc aacgtcataa tgtcccggcc gcggtgagtg atttgcgcgc cgcgctggaa      1920
     ctggaaccga ataatagcaa cacccaggca gcgcttggtt acgccttgtg ggatagcggt      1980
     gatatcgcac agtcgcggga aatgctcgaa caggcgcata aagggctacc ggacgatccg      2040
     gcactgatcc gacaactggc ctatgtgaac cagcgtctgg atgacatgcc tgcgacgcag      2100
     cactacgccc ggctggtgat tgatgacatt gataatcagg cgctgataac cccactgacc      2160
     ccagagcaaa atcagcaacg cttcaatttc cgccgtctgc atgaggaggt cggtcgccgc      2220
     tggacgttca gtttcgattc ttccatcggc ttgcgttccg gggcaatgag taccgctaac      2280
     aataatgttg gcggcgcagc gccagggaaa agctatcgta gctacgggca actggaagcc      2340
     gaataccgca tcggacgcaa tatgctgctg gaaggcgacc tgctctcagt ttatagccgc      2400
     ttctttgccg ataccggaga aaacggggtg atgatgccgg tgaaaaatcc gatgtccggc      2460
     accggtctgc gctggaagcc gctgcgcgat cagatctttt tcctcgccgt cgaacagcag      2520
     ttgccgctga acgggcaaaa tggcgcatcc gataccatgc tgcgcgccag cgcctcattc      2580
     tttaatggcg gcaaatacag cgacgaatgg cacccgaacg gttcaggctg gtttgcccaa      2640
     aacctgtacc tcgatgcggc gcaatatatc cgccaggata ttcaggcgtg gacggcagat      2700
     tatcgcgtca gctggcatca gaaggtagct aacggacaga ctattgagcc ttacgctcac      2760
     gttcaggaca acggctatcg tgataaaggc actcagggcg cgcagcttgg cggtgtcggg      2820
     gtccgctgga atatctggac cggcgagacg cactacgacg cctggccgca caaagtcagt      2880
     ctcggcgtcg agtatcaaca tacctttaag gcgattaatc aacgtaacgg agagcgcaac      2940
     aacgcgtttc tcaccattgg agtgcactgg taa                                   2973
//

If you have problems or comments...

PBIL Back to PBIL home page