(data stored in ACNUC7421 zone)

EMBL: BA000007.PE574

BA000007.PE574       Location/Qualifiers
FT   CDS_pept        complement(664602..665738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0602"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34025"
FT                   /db_xref="GOA:Q8X565"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X565"
FT                   /protein_id="BAB34025.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDLGETHLNFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRRAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKESEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVVNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVFAGSGLS"
     atggaactta aaaaattgat ggaacatatt tctattatcc ctgattacag acaagcctgg        60
     aaagtggaac ataaattatc ggatattcta ctgttgacta tttgtgccgt catttctggt       120
     gcagaaggct gggaagatat agaggattta ggggaaacac atctcaattt tttgaagcaa       180
     tatggtgatt ttgaaaatgg tattcctgtt cacgatacca ttgccagagt tgtatcctgt       240
     atcagtcctg caaaatttca cgagtgcttt attaactgga tgcgtgactg ccattcttca       300
     gatgataaag acgtcattgc aattgatgga aaaacgctcc ggcactctta tgacaagagt       360
     cgccgcagga gagcgattca tgtcattagt gcgttctcaa caatgcacag tctggtcatc       420
     ggacagatca agacggatga gaaatctaat gagattacag ctatcccaga acttcttaac       480
     atgctggata ttaaaggaaa aatcatcaca actgatgcga tgggttgcca gaaagatatt       540
     gcagagaaga tacaaaaaca gggaggtgat tatttattcg cggtaaaagg aaaccagggg       600
     cggctaaata aagcctttga ggaaaaattt ccgctgaaag aattaaataa tccagagcat       660
     gacagttacg caatgagtga aaagagtcac ggcagagaag aaatccgtct tcatattgtt       720
     tgcgatgtcc ctgatgaact tattgatttc acgtttgaat ggaaagggct gaagaaatta       780
     tgcgtggcag tctcctttcg gtccataata gcagaacaaa agaaagagtc agaaatgacg       840
     gtcagatatt atatcagttc tgctgattta accgcagaga agttcgccac agcaatccga       900
     aaccactggc acgtggagaa taagctgcac tggcgtctgg acgtggtagt gaatgaagac       960
     gactgcaaaa taagaagagg aaatgcagca gaattatttt cagggatacg gcacattgct      1020
     attaatattt tgacgaatga taaggtattc aaggcagggt taagacgtaa gatgcgaaaa      1080
     gcagccatgg acagaaacta tctggcgtca gtctttgcgg ggagcgggct ttcgtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page