(data stored in ACNUC7421 zone)

EMBL: BA000007.PE575

BA000007.PE575       Location/Qualifiers
FT   CDS_pept        complement(666201..667535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0603"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34026"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR7"
FT                   /protein_id="BAB34026.1"
FT                   /translation="MTASGTGLGYGEGDESYGYDSCGYLKAQSAGGHRISEETDQYAGG
FT                   HRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
FT                   DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDELYSVRHLVFNGFELISQQCSRV
FT                   RQPHPSVAPQWVTRTNHAVNDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYP
FT                   DPRGERDAEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRY
FT                   VPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKL
FT                   GIKVIRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEAL
FT                   GRLSREEHVLNEILKSKNLFNEAEIAHAIKYVEGLREKFMMGLIN"
     gtgacagcct caggcaccgg gctgggctat ggcgaaggcg atgagtccta tggctatgac        60
     agctgtggct acctgaaggc gcagtctgcg ggcgggcacc ggataagtga agagactgac       120
     cagtatgccg gaggccaccg gctgaaacag gccggaaaca cgcagtatga ctatgacgcc       180
     gcaggccgga tggtcagccg caccagacac cgtgacggct atcgcccgga aacagagcgg       240
     ttccggtggg acagccggga ccagctgacc gggtattgca gcgcacaggg tgagcagtgg       300
     gaataccgcc acgacgccag cggcagacga acagagaaac gctgcgaccg gaagaaaatc       360
     cgcttcacgt acctgtggga cggcgacagt attgcggaaa tccgggaata ccgcgatgat       420
     gaactgtaca gcgtacggca cctggtgttt aacggctttg agctgataag ccagcagtgc       480
     agccgggtac ggcagccgca cccgtccgtg gccccgcagt gggtgacacg aacgaatcat       540
     gcggtgaacg acctgacggg ccgtccgctg atgctcttta acagtgaagg taaaaccgtc       600
     tggcggccgg gacagaccag cctgtggggg ctggcactca gcctgcccgc agacacagac       660
     tacccggacc cgcgcgggga gcgggacgcg gaagccgacc ccggcctgct gtatgcagga       720
     cagtggcagg atgcagaatc ggggttgtgc tataaccggt tccgatatta cgagccggaa       780
     accgggatgt acctggtgag tgatccactg gggttgcagg gaggggagca gacttaccgg       840
     tatgtgccga atccttgtgg gtgggttgat ccgctgggat tggctgcaag ttctaaaatc       900
     agcagtttga tggactatat tggcgatggt cgtcgtgtta gtgggcatac gggtttcctg       960
     gatggggttc gtttatcacg tagtcaaata aacaatattg ctaaagaaat ggagaagcta      1020
     ggaattaaag taataaggaa agcagataaa tatttgccac caaatgctag ggcagctttt      1080
     gattatggtc ttcgcaatat ttatcttagg aaaaatgcta ccttatatga ggtgtatcat      1140
     gaagtgattc atgctaagca atttgcgaaa attggacgag aagcatacga agcactagga      1200
     cgtttatcta gggaggaaca cgttctaaat gaaatattaa aaagtaaaaa tttattcaat      1260
     gaagcggaaa tagctcatgc cataaaatat gttgagggat tgagagaaaa attcatgatg      1320
     ggactaataa attga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page