(data stored in ACNUC7421 zone)

EMBL: BA000007.PE576

BA000007.PE576       Location/Qualifiers
FT   CDS_pept        complement(667704..668111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDX7"
FT                   /protein_id="BAB34027.1"
FT                   /translation="MKEIDLLYENIYQLLIKPYLLDLSSQSGKKIELNYTCKIKDAADE
FT                   IKGSMIFNDVDGKQKATCTIRVLILKTFHDGRYRFVIESVIYDLINNYSGFILTGRLFW
FT                   QGEGFGHELFPVTNKYNAWRWKNKKIIDISW"
     atgaaagaga ttgatttatt atatgaaaat atttatcagc ttttaattaa accttaccta        60
     ctcgatcttt ctagccagtc tggaaaaaaa atagaattaa attacacatg caaaataaaa       120
     gatgctgctg atgaaataaa gggtagtatg atttttaatg atgtagatgg taaacaaaaa       180
     gcaacttgca ctatcagggt gttaatacta aaaacatttc acgatggtcg ttatagattt       240
     gtaattgaat ctgtgattta tgatttaatt aataattaca gtggatttat tttaacgggg       300
     agattgtttt ggcaagggga aggttttggc catgaattat tccccgtgac aaacaaatat       360
     aatgcttgga gatggaaaaa taaaaaaata atagatattt cttggtaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page