(data stored in ACNUC7421 zone)

EMBL: BA000007.PE577

BA000007.PE577       Location/Qualifiers
FT   CDS_pept        complement(668129..672979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0605"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34028"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCN2"
FT                   /protein_id="BAB34028.1"
FT                   /translation="MSEGPGGPQGATAGGTLAMRMLSQRAMAASQMKRAANDKAIAQML
FT                   ASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPAL
FT                   MYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSKNVKINGKPAARAAVTLPPPPPP
FT                   GAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASL
FT                   LFPAGPVLMEFATMVGGRGEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQP
FT                   AARKGDKLECSAAIVEGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAG
FT                   LLGKLGNLAKLGKLGNLLGKSGKLLGAKLGALLGKTGNSLKSIANKVIRWVTDPVDPVT
FT                   GAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDVIS
FT                   LGATLNFAFDGESDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPV
FT                   TDDTSDDRLAHSPADRMYMLGGMSDTASNRITFERDTQYRITGVSHTDGIRLKLTYHAS
FT                   GYLKAIHRTDNGIQTLATYEQDARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGR
FT                   CVTVTGAEGYYNATLDYGDGCTTVTDGKGIHRYYYDPDGNILREEAPDGSTTTYEWDEF
FT                   HHLLARHSPAGRVEKFEYNAAHGQLSRYTAADGADWQYCYDERGLLSNITAPAGQTWTQ
FT                   QCDERGLPVSLVSPQGEETRLAYTPQGLLSGIFRQDERRLGIEYDHHNWPETLTDVMGR
FT                   EHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAGTGAEGFRYDRHGNLLAYTD
FT                   GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYLYILDNCGRV
FT                   TEERDWGGVVCRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKS
FT                   GRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHP
FT                   DGSLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQP
FT                   VSQRAGLFPAEATWGGLLPSLLREYRYDSAGNVSGVTSREDYGRETHREYRLDRNGQVT
FT                   AVTASGTGLGYGEGDETYGYDSCGYLKAQSAGRHRISGETDQYAAGHRLKQAGNTQYDY
FT                   DAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYRSAQGEQWEYRHDASGRRTEKRCDR
FT                   KKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVT
FT                   RTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYPDPRGERDPEADPG
FT                   LLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGYIDPLGL
FT                   AICQLARWTKWGSEQSNISDVLNSLGNRALKYANGDWIKSEAAFNKYINMINKRLELTG
FT                   SKFRVEIQPAIKNGERVPATTNGPFKVNGKWTSGTHYTGGSKRLDAGIIDITSPTNQYG
FT                   LHPVIEGFDITLNKTKPSAVDIYSDVFGGIDINDFRL"
     atgagtgaag gaccaggcgg gccacaggga gcgaccgcag gcggtacgct ggcaatgcgg        60
     atgctgtcgc agcgggcgat ggccgccagc cagatgaaac gggcagccaa cgacaaagcc       120
     attgcacaga tgttggcatc aaaaaagtct ggcccccccg ccgccaggct gggcgatgaa       180
     attcagcaca agagtttttt gggggcgctg gcaggggccg tgctgggggc gatagtgacc       240
     atagcagaag gttgcctgat tatggccgcc tgtgccaccg gcccttatgc gctggttctg       300
     gtgcctgcgc tgatgtatgc cagctataag gcgagtgatt atgtggagga gaaacagaac       360
     cagcttgaat catggataaa cagcttttgt gacacggacg gcgccatcaa taccggttct       420
     aaaaatgtaa aaattaacgg aaagccagca gcccgtgcag ccgtcaccct tccccctcct       480
     cccccacctg gagcaatacc tgaagtccca cagggggaac cctcatgggg tgatattgcc       540
     actgacctgc ttgaatcggc agcggaaaaa gcagtaccac tggcgaaggc ctgggggaac       600
     gctgttatca ccctgacgga cagcaatgcc ggttttatgg atcgcgtcag cgccggcgca       660
     tcgcttctgt ttcccgccgg tccggtatta atggagtttg ccaccatggt gggcgggcgt       720
     ggcgaaatca aaaaagatgt ggatttcccg gaagccggtg aggacacggc gctctgcgac       780
     aaggagaaca aaccaccgag gatagcccag ggcagcagca acgtctttat caacaatcag       840
     cctgccgcgc gcaagggcga caaactggag tgcagcgcgg caatcgtgga aggttcgccg       900
     gacgtcttta ttgggggtga gcaggtcacc tatctggata tccagccgga gttcccgcca       960
     tggcagagaa tgatcctggg aggaataacg atagccagct atcttctgcc gccagcagga      1020
     ctgctgggaa aactggggaa tctggcgaaa ctgggcaaac tgggaaacct gctggggaaa      1080
     agcggtaagc tgctgggcgc aaagctcggc gcgttgctgg ggaaaacagg taattcgtta      1140
     aaaagtattg ccaataaagt catcagatgg gtaacagatc ctgtcgatcc ggtaaccggc      1200
     gcatactgcg acgaacgtac cgactttacg ctgggccaga cactccccct ctccttcacc      1260
     cgtttccaca gttctgtact gccgctgcat ggcctgacgg gcgtgggctg gagcgactcc      1320
     tggagcgaat acgcctgggt gcgtgaacag ggaaaccggg tggatgtcat cagcctggga      1380
     gccacgctga acttcgcctt cgacggtgaa agtgatacgg cggttaaccc gtatcacgcc      1440
     cagtacattc tgcgccgccg tgatgattat ctggagctgt tcgacaggga tgcactgagc      1500
     agccgcttct tttatgacgc ctttccggga atgcgtctgc gccacccggt gactgacgat      1560
     accagcgatg accgcctggc acacagcccc gcagaccgga tgtacatgct gggcgggatg      1620
     agcgacaccg ccagcaaccg catcacgttt gagcgcgaca cccagtaccg gatcacgggt      1680
     gtcagtcaca ccgacgggat ccggcttaaa ctgacgtacc acgccagcgg ctacctgaaa      1740
     gccattcacc gcacggataa cggcatacag acgctggcga cctacgaaca ggatgcgcgg      1800
     ctggactacc acctgtttta tgagtacgac gctgcggacc ggatcatccg ctggtccgat      1860
     aacgaccaga cgtggagccg tttcacctac gatgcacagg gccggtgcgt gaccgtcacc      1920
     ggggcggagg gctattacaa cgccacgctg gactatggtg acggctgcac caccgtgacg      1980
     gacggcaagg gcattcaccg ttattactat gatcctgacg gcaatattct gcgggaagaa      2040
     gcgccggacg gcagcaccac cacgtatgaa tgggatgaat tccatcacct gctggcccgc      2100
     cactcccctg ccgggcgggt ggagaagttt gaatacaacg ccgcacacgg tcagttaagc      2160
     cgttacacgg cggcagacgg cgcggattgg cagtactgct atgatgagcg cggcctgctc      2220
     agcaacatca ccgcccctgc cgggcagacg tggacgcagc agtgtgatga acgcggcctg      2280
     ccggtgagtc tggtatcgcc acagggcgaa gagacccggc tggcgtacac ccctcagggg      2340
     ctgctgtcgg ggatattccg ccaggatgaa cggcgtctgg gcatagagta cgaccaccac      2400
     aactggccgg aaacactcac cgacgtgatg ggccgcgaac accacaccga atacagcggt      2460
     cacgacctgc cggtgaagat gcgcggcccc ggcggtcagt cagtgcggtt gcagtggcag      2520
     cagcaccata aactgagtgg ccttgagcgg gcaggaaccg gcgcggaagg attccgctac      2580
     gaccgccacg gcaacctgct ggcgtacacg gacggtaacg gcgttgtctg gacaatggag      2640
     tacggcccgt ttgatttgcc ggtggcgcga acggacggtg aaggccaccg ctggcagtac      2700
     cgctacgata aagacacgct gcaactgaca gaagtcatta acccgcaggg cgagtcttat      2760
     ctttatattc tggacaactg tggccgggtg acggaagaac gtgactgggg cggcgtggtc      2820
     tgtcgttacc gttatgacgc tgatggcctg tgtaccgcca gggtcaacgg cctggaggaa      2880
     accatcctct acagccggga tgccgcaggc cgcctggcag aagtcatcac tccggaaggc      2940
     aaaacgcagt atgcgtatga caaatccggc aggctgacgg gtatcttcag cccggacggc      3000
     acatcacagc gcaccggcta tgatgaacgc gggcgggtga atgtcaccac tcagggccga      3060
     cgggccattg aataccacta ccccgacgaa cacaccgtca tccgctgtat cctgccaccg      3120
     gaagatgaac gcgacagaca ccccgacgga tccctgctga aaaccacata ccgctacaac      3180
     gccgccggag aactgacgga ggttatcctg ccgggggatg agacgctgac gttcagccgt      3240
     gatgaggcgg gacgtgaagt gctccggcac agtaaccggg gttttgcctg tgaacagggc      3300
     tggaatgcag ccggtcagcc tgtcagccag cgcgccggac ttttcccggc ggaagccaca      3360
     tggggcggac tgctcccttc actgctacgg gaataccgtt acgacagcgc gggtaacgta      3420
     tcaggcgtca ccagccggga agattacgga cgggaaacac accgggagta ccggcttgac      3480
     cggaacggcc aggtcacggc ggtgacagcc tcaggcaccg ggctgggcta tggcgaaggc      3540
     gacgagactt atggctatga cagctgcggc tacctgaagg cgcagtctgc gggcagacac      3600
     cggataagcg gagagactga ccagtatgcc gcaggccacc ggctgaaaca ggccggaaac      3660
     acacagtatg actatgacgc cgcaggccgg atggtcagcc gcacaaaaca ccgtgacggc      3720
     taccgcccag aaacagagcg gttccggtgg gacagccggg accagctgac cgggtatcgc      3780
     agcgcacagg gggagcagtg ggaataccgc cacgacgcca gcggcagacg gacggaaaaa      3840
     cgctgcgacc ggaagaaaat ccgttttacg tacctgtggg acggcgacag tattgcggaa      3900
     atccgggaat accgcgatga taaactgtac agcgtaaggc acctggtgtt taacggcttt      3960
     gagctgataa gccagcagtt cagccgggta cgacagccgc atccgtccgt ggccccgcag      4020
     tgggtgacgc gaacgaatca tgcggtgagc gacctgacgg gccgcccgct gatgctcttt      4080
     aacagtgaag gtaaaaccgt ctggcggccg gggcagacca gcctgtgggg gctggcactc      4140
     agcctgcccg cagacacaga ctacccggac ccgcgcgggg agcgggaccc ggaagcggac      4200
     cccggcctgc tgtatgcggg acagtggcag gatgcagaat cggggctgtg ctataaccgg      4260
     ttccggtact acgagccgga aaccgggatg tacctggtga gtgatccgct ggggttgcag      4320
     ggaggggagc agacttatcg gtatgtgccg aatccttgtg ggtatatcga tcctttgggg      4380
     ctggctatat gtcagttagc ccgctggacg aaatggggga gtgagcaaag caacatatct      4440
     gatgttttga actcattagg gaatagagca cttaaatatg ctaatggtga ttggataaaa      4500
     tcagaggctg cattcaataa atacataaac atgataaata aaagactaga attaacaggt      4560
     agtaaattta gagttgagat tcaaccagcc ataaaaaatg gagagcgagt tcctgcgaca      4620
     acgaatggac catttaaagt aaatggtaag tggacatccg gcactcatta tacaggtggt      4680
     tccaaacgtc tagatgccgg tattattgat atcacatctc ctacaaacca atatggatta      4740
     catccagtta ttgaaggatt tgatataaca cttaataaaa caaaaccatc agcagtggat      4800
     atatattcag atgtgtttgg tgggattgat attaacgact ttcggttata a               4851
//

If you have problems or comments...

PBIL Back to PBIL home page