(data stored in ACNUC7421 zone)

EMBL: BA000007.PE578

BA000007.PE578       Location/Qualifiers
FT   CDS_pept        complement(672999..673460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34029"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG68"
FT                   /protein_id="BAB34029.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITREPVSQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
     atgcagttca cttttaatga aggtcatatt caactgccat cgcaatggca ggatcagtcg        60
     atgcaggtcc tggtatccac ggataacagt ggcatcaacc tggtcattac ccgcgaaccc       120
     gtttcacagg gaaccctgac accagagctg taccaggaaa cgctggcgct gtaccagggc       180
     aaacttgatg ggtacaccga acatgcctgc cgggaaatca ctctggcaga ggccccggcc       240
     tggctgctgg attattcctg gaacggtccg gaagatgaag ggaatcaggg gcggattagc       300
     cagatagccg tattccagcg gcgtggagat acgctgctga ccttcacttt cagcacctcc       360
     ttatccctga agaacagtca aaagacgatg ctgctggagg tgataaagag cttcaccccg       420
     ttgccaccgg agaatgacat ccaaaaggac cagccgcgct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page