(data stored in ACNUC7421 zone)

EMBL: BA000007.PE579

BA000007.PE579       Location/Qualifiers
FT   CDS_pept        complement(673488..675389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0607"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34030"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="PDB:3WIT"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBY5"
FT                   /protein_id="BAB34030.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLTQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMEGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGAGTA
FT                   LENHFAVIPADRTWRPQPRLKPLVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGG
FT                   EGNGIQAYTAIKEIMLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
     atgtcaaccg gattacgttt cacactggaa gtggacggcc tgccaccgga cgcttttgcg        60
     gtggtttcct ttcatctcac ccagtcactc tcttcgctct tttccctcga tctctccttg       120
     gtcagccagc agtttctctc ccttgaattt gcgcaggtgc tggacaaaat ggcctacctg       180
     acaatatggc agggtgatga tgtacagcgc cgggtgaaag gtgtggtgac ctggtttgaa       240
     ctgggggaga acgacaaaaa ccagatgctg tacagcatga aggtgcaccc gccgctgtgg       300
     cgtgccggtc tgcgccagaa cttccgtatc ttccagaacg aggacatcaa aagcatcctc       360
     ggcacgatat tgcaggaaaa cggggtgacc gagtggagtc cgctgttcag tgaaccgcat       420
     ccttcccgtg agttttgtgt ccagtacggt gagactgatt acgatttcct gtgccggatg       480
     gcggcggagg aaggcatctt cttttatgag gagcatgctt acaaaagtac cgaccagagc       540
     ctggtgctgt gcgacacggt ccgccatctg cccgaatctt ttgaaatccc ctggaacccg       600
     aacacccgta ccgaggtgag caccctctgc atcagccagt ttcgctacag cgcacaaatc       660
     cgcccttctt ccgtggtgac caaagactac acctttaaac gccccggctg ggcaggacgt       720
     tttgatcagg aaggccagca ccaggattac cagcgcacgc agtatgaggt gtatgactac       780
     cccggacgtt tcaagggcgc ccacgggcag aactttgccc gctggcagat ggagggctgg       840
     cgaaacaatg cagaaaccgc gcggggaatg agtcgctcgc cggagatatg gccgggacgg       900
     cgaattgtgc tgacggggca tccgcaggcg aacctgaacc gggaatggca ggtggtggca       960
     agtgaactgc acggcgagca gccgcaggcg gtgccgggaa ggcggggagc agggacggcg      1020
     ctggagaacc attttgcggt gatcccggca gaccggacat ggcgacccca gccgcggcta      1080
     aaaccgctgg tggacggtcc gcagagcgcc gtcgtgacgg ggccggaggg tgaggaaatc      1140
     ttctgtgatg aacatggccg agtgcgggtg aaattcaact gggaccgtta taacccggca      1200
     gaccaggaca gctcgtgctg gatccgtgtg gcacaggcgt gggcaggcac cggttttggc      1260
     aacctggcga taccgcgtgt gggtcaggag gtgatagtgg acttcctcaa cggcgatccg      1320
     gaccagccga tcattatggg gcgcacctac caccaggaaa accgcacccc cggcagcctg      1380
     ccggggacga agacgcagat gaccatccgt tccaaaacgt atatgggcag cgggtttaat      1440
     gagctgaagt ttgatgatgc gacagggaga gaacaggtct acatccacgc gcagaagaac      1500
     atggataccg aagtgctcaa cgaccgtacc accaccgtaa aacacgatca tcgcgaaacc      1560
     gtaaaaaatg accagacggt cacgatccag gaaggtaacc gccttcttac ggtggaaaaa      1620
     ggccacaaga tcaccggagt actgaaaggg tctttatctg aggatgtctt tcaggacaga      1680
     ggcacgattg ccggttcggt gcatgttgac gctgtaaaca atggtggcga aggcaacggt      1740
     atacaggctt atacggcaat taaggaaatt atgctggccg tggaggaaag caaaattgcg      1800
     ctgacgccgg atggcattca gctacaggtc ggggaatcaa cggtaatcag gctgtcgaag      1860
     gatggcatca ccatcgtggg cggttctgtt ttcatcaact ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page