(data stored in ACNUC7421 zone)

EMBL: BA000007.PHOE

BA000007.PHOE        Location/Qualifiers
FT   CDS_pept        complement(296157..297212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECs_0268"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33691"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33691"
FT                   /db_xref="GOA:Q8X7N5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N5"
FT                   /protein_id="BAB33691.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
     atgaaaaaga gcactctggc attagtggtg atgggcattg tggcatctgc atccgtacag        60
     gccgcagaaa tatataacaa agacggtaat aaactggatg tctatggcaa agttaaagcc       120
     atgcattata tgagtgataa cgacagtaaa gatggcgacc agagttatat ccgttttggt       180
     tttaaaggcg aaacacaaat taacgatcaa ctgactggtt atggtcgttg ggaagcggag       240
     tttgccggaa ataaagcgga gagtgatact gcacagcaaa aaacgcgtct cgcttttgcc       300
     ggattgaagt ataaagattt gggttctttc gactatggcc gtaacctggg cgcgttgtat       360
     gacgtggaag cctggaccga tatgttcccg gaatttggtg gcgactcctc ggcgcagacc       420
     gacaacttta tgaccaaacg cgccagcggt ctggcgacgt atcggaacac cgacttcttc       480
     ggcgttatcg atggcctgaa cttaaccctg caatatcaag ggaaaaacga aaaccgcgac       540
     gttaaaaagc aaaacggcga tggcttcggc acgtcattga catatgactt tggcggcagc       600
     gatttcgcca ttagtggggc ctataccaac tcagatcgca ccaacgagca gaacctgcaa       660
     agccgtggca caggcaagcg tgcagaagct tgggctacag gtctgaaata cgatgccaat       720
     aatatttatc tggcaacttt ttattctgaa acacgcaaaa tgacgccaat aactggcggc       780
     tttgccaata agacacagaa ctttgaagcg gtcgctcaat accagtttga ctttggtctg       840
     cgtccatcgc tgggttatgt cttatcgaaa gggaaagata ttgaaggtat cggtgatgaa       900
     gatctggtca attatatcga tgtcggggct acatattatt tcaacaaaaa tatgtcagcg       960
     tttgttgatt ataaaatcaa ccaactggat agcgataaca aattgaatat taataatgat      1020
     gatattgtcg cggttggcat gacctatcag ttttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page