(data stored in ACNUC7421 zone)

EMBL: BA000007.PRFH

BA000007.PRFH        Location/Qualifiers
FT   CDS_pept        291590..292090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECs_0263"
FT                   /product="peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33686"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33686"
FT                   /db_xref="GOA:Q8X7N9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N9"
FT                   /protein_id="BAB33686.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
     gtgctggaaa cagaaacggg ccgctactct gacacgctgc gttcggcgct gatttctctg        60
     gatggcgaca acgcatgggc gttaagcgaa agttggtgcg gcactattca gtggatttgt       120
     ctgagtccgt atcggcctca tcatgggcgc aaaaactggt ttctgggcat tgggcgtttt       180
     accgctgatg agcaggaaca atcggatgca atccgttatg agacgctgcg tccgtcgggg       240
     ccgggcggtc aacatgtcaa taaaaccgac tcggcggtac gcgccacgca tctggcaacc       300
     gggattagcg tgaaggttca gtcagaacgc agccagcatg ctaacaaacg gctggcgcga       360
     ttgctgattg cctggaagct ggagcagcag caacaggaaa atagcgcagt gctgaaatcg       420
     cagcggcgaa tgttccatca ccagattgaa cgtggcaacc cgcgacgaac gttcacaggg       480
     atggctttta tcgaaggata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page