(data stored in ACNUC7421 zone)

EMBL: BA000007.PRIC

BA000007.PRIC        Location/Qualifiers
FT   CDS_pept        complement(556181..556708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECs_0520"
FT                   /product="primosomal replication protein PriC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33943"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK2"
FT                   /protein_id="BAB33943.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDKAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     gtgaaaaccg ccctgctgct ggaaaaactg gaaggacagc tcgctacgct gcgtcagcgt        60
     tgtgccccgg tgtcacagtt cgccacgcta agtgctcgtt tcaacaggca tctttttcag       120
     actcgtgcga caacactaca ggcttgtctc gacaaggcgg gcgataatct ggctgcgctt       180
     cgtcatgcag ttgagcaaca gcaactgccg caagtcgcct ggctggcaga acatctggcg       240
     gcgcaactgg aggctatagc gcgtgaagcc acagcctggt cgctacgcga gtgggatagc       300
     gcaccacccc aaattgcccg ctggcagcgt aaacgtattc agcatcagga ttttgagcgg       360
     cggctacgtg agatggttgc cgaacgtaga gcccgcctgg cgcgggtgac cgatctcgtg       420
     gaacagcaaa cgctgcatcg tgaagtggaa gcctatgaag cgcgcctggc acgctgccgc       480
     catgcgctgg aaaaaatcga aaacaggtta gcgcgtttaa cccgctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page